Xuebing Du
PUT YOUR BEARD IN MY MOUTH
RMH

❣ Chile in a Photography ❣
will byers stan first human second
Stranger Things

Product Placement
Noah Kahan

#extradirty

No title available
Sade Olutola
𓃗

PR's Tumblrdome
cherry valley forever
EXPECTATIONS
Jules of Nature
No title available

Andulka
$LAYYYTER
KIROKAZE

seen from Israel
seen from Türkiye
seen from Brazil
seen from Argentina

seen from Argentina
seen from United States

seen from United Kingdom

seen from Bangladesh
seen from France
seen from Ireland
seen from Panama

seen from United States
seen from Italy
seen from United States
seen from United States

seen from United States
seen from United States
seen from United States
seen from United States
seen from Argentina
@sniffimfarts
Camping Fart Slave Training - Part 1
I didn't want to go camping with Joeseph due to not wanting to be in an enclosed space with him for an extended period of time.
We had been friends since school, always around at each other's houses but recently Joeseph started to enjoy teasing me by being gross, farting around or sometimes on me, burping constantly and sometimes making me wake up with his shoe tied to my face.
However, nothing could prepare me for this.
I arrived at the campsite Joeseph stood there, his blonde scruffy hair blowing in the wind and his silky tracksuit bottoms and the tent that didn't look too big.
As I approached I could see the campfire on with a disposable BBQ cooking some burgers and sausages. I went into the tent and set up my side, there wasn't much room in the tent however as I moved something fell out of Joeseph's bag, what looked like a gas mask from the war...
"Mate what the f**k is this?" holding the gas mask in the air, "Oh that's for later don't stress man food ready" Joeseph replied with a beaming smile on his face.
Confused I finished getting sorted and headed out.
It was cold outside so we just sat and quickly ate, the food was lush. Unfortunately, the quiet location wed chosen was ruined by a large rumble in Joesephs belly then a huge fart erupting out of his ass.
He laughed as I companies about the smell, even outside it was putrid. "Don't do that in the tent man we will both die" smiling Joeseph responded, "Oh don't worry I have a solution for that".
I just laughed it off, we chatted some more but then it was too cold to stay out so I headed to the toilet while Joeseph got sorted.
I entered the tent to Joeseph topless, with his tracksuit bottoms still on and no socks, he was laying on top of his sleeping bag and was stroking his dick.
I laid down in my sleeping bag and zipped it up, shortly after a smell started to fill the whole tent, a rancid eggy smell from Joeseph ass.
"F**k man that's rank, you said you weren't gonna do this," I said while choking on the putrid smell that had filled our small tent.
At that very moment Joeseph sat on my chest, looking down at me he smiled and said "Ah yes the solution" he grabbed the gas mask I had seen before holding it up and inspecting it "You see, I want a fart slave full time as my gas has been getting so bad. So I thought you'd make a good candidate"
I started to struggle in the sleeping bag "Mate what?!? Please don't I can't take this anymore" As I finished that sentence Joeseph gagged me with one of his dirty socks. Ensuring I could no longer speak.
He placed the gas mask over my face, making sure it was airtight. He placed his hand over the filter of the gas making me squirm as I couldn't breathe and released it once I reacted "Ah good, no escape".
He then attached a specially fitted hose to the gas mask testing that the same way to ensure it was airtight. He then got off me, on his knees he turned round to show me a zip on the back of his tracksuit bottoms. He unzipped it and attached the other end of the hose to a specially fitted attachment.
The foul smell of his ass shot down the hose and into the mask, filling it within seconds of his musty ass smell.
He then got out some tape and taped it around my sleeping bag meaning I couldn't get out of it, secured into it and secured to his ass. I couldn't even move my hands out of the bag because of his tape.
"Ok, fart sniffer here is what's gonna happen, when we leave this campsite your gonna be under my control forever. You'll want to do nothing but inhale my gas". He said as he stroked my dick.
I thought to myself that it won't happen, how could I love and beg for his farts when they were so disgusting and made me feel ill.
"What I am going to do is make sure that every time I fart I stroke your dick, I want you to think of the pleasure you get down there every time I fart. I am going to make you cum from my gas"
I squirmed again and once tried to reason in my head what was happening. Then it his me, the foul stench, he had farted
I began to squirm from the stench that had begun to fill the mask until the hose started to vibrate and then the sound came to PPFFFRRRTTTTRRRPPPPPPPPPPPPPPPSSSSSSSSSSSSSS
"Oh fuck that felt good," Joespeh said as he laughed loudly "How was that fart sniffer," he said while stoking my dick which was soft.
I was squirming around, the tent shaking. Joseph laughed as he released silent farts continuously into the mask. This was hell.
Camping Fart Slave Training - Part 3 (Final Part)
I woke up mummified inside a sleeping bag and herd chatter outside. One voice was definitely Joeseph and the other ones I don’t know who I moved around slightly and Joeseph‘s face peered into the tent, looking at me “Hello again fart slave, I’ve brought some friends” two other guys, in full tracksuits looks back at me one smacked his arse as he looked into my eyes.
They all got into the small tent. Once inside Joeseph started rubbing my dick once again “it’s time for your last challenge fart slut” when I tried to reply all it came out was moans. I slowly realised that the gas mask I was wearing was different to the one before and my mouth had also been gagged with a pair of horrible tasting, dirty socks.
As I looked down as much as I could, I could see three tubes coming from the bottom of the gas mask. This couldn’t be good each of the lads grabbed of the tubes and attached it to their arsehole. I began to smell the horrible smell of three arses mixed together, creating a horrible stink, unlike anything I have ever smelt before.
Joseph started to rub the sleep bag, which felt comforting, which is something I needed, knowing what was gonna happen to me. “Ok, so you’re gonna take all of our farts until you agree to sign this contract”. what contract was Joeseph on about? I would never agree to this! I let out a moan shaking my head. Joeseph lent over and looked into my eyes. He started reading the contract.
“Part one, I promise to sniff my masters farts, whenever I am required, and no matter where I am.
Part two if my master has friends round who need to fart, I can be used as a filter for that rancid gas.
Part three, you are not allowed to cum unless you are sniffing farts.
Part four, you promised to move into Joeseph‘s flat and become his bitch for the rest of your life.”
I shook and disagreement all parts of this contract. I didn’t want to accept it. I didn’t want to be a fart slave for the rest of my life. I just wanted to be released.
Joeseph moved his hand down to my cock and started rubbing it. He lent back “ok boys here we go”. The first fart ripped down the gas mask tube into my face. All I could do is sniff it I start to moan as the next fart rumbled down the hose, followed by more and more and more gas.
Whilst this was happening, Joeseph was rubbing my cock forcing me to be horny to this extensive torture.
One of the other lads lent over and looked into my eyes. He put his hand on the side of my face and asked me to guess what he had for dinner before releasing a massive stinky fart into the tube. I maoned and shaked as he laughed.
This torture of non-stop farts went on for 10 minutes straight without any break. One of them was always farting. Joeseph lent over me again and said it could be all over if I just signed the contract in my head it was beginning to think like the only option I had for survival.
Soon the three guys stopped, Joseph said to them “I think we need the next stage” “Yes sir” replied one of the lads.
My gas mask and gag was removed, I could finally breathe somewhat fresh air. Joeseph and the other two guys, then got out a massive sleeping bag. It looked like a triple one. It could fit multiple guys and at once I was told to get into the bottom of it, I refused. Joeseph climbed on me cuffing my hands and my feet and dragged me in.
I was pushed down to the bottom and then the three lads got in the top. Their feet went on my face, which stunk about as bad as their farts. Joeseph reached down to me and attached a collar to my neck. I was now completely enclosed in this Dutch oven.
I felt the collar pulling and I was dragged up to one of the lads ass. He put his hand on the back of my head, and pushed my face into his rancid, bare arse, and proceeded to start farting on my face no matter how much I tried to pull away, I couldn’t. When I did manage to get a little bit away from his arse, the smell didn’t get any better as the smell was just filling the whole of the sleeping bag.
I was pulled to the next guy who proceeded a fart on my face multiple times and kept on telling me to lick their arse. Eventually, I did as I was told and stick my tongue in. Their arsehole was disgusting. You could taste their farts they had created.
Finally, Joeseph pulled me over to his arse. I could always recognise his gas after all. I’ve taken it for a good few days at this point. Joeseph pulled me with the collar, forced his dick into my mouth and forced me to deep throat him as he released some eggy gas around me. I was now sniffing his rancid farts and sucking his giant dick.
This went on for a good 10 minutes before he came into my mouth. He allowed me to take his dick out of my mouth and pushed me into his arse where he released another few bubbly fart right in my face I felt so submissive. The other guy pulled me over to theirs. Most sat in between them. Both of them sat on my face at once. I had one ass on either sides of my face.
Both of them start releasing eggy farts right onto my nose. I had no escape. I started shaking. I still have to cum from Joeseph‘s cock dripping out of my mouth as I was forced to endure more gas the inside of the sleeping bag, stank of rancid fart and cum. I shouted out at the top of my voice “I’ll sign it, I’ll sign it”.
And right then too much of disgusting farts hit my face. I start shaking from the stench again, and then I felt the collar pull me back up to the surface.
Joeseph was sat in the tent with the pen in his hand, and the contract on the ground. He gave the pen to me and instructed me to sign it. I nervously signed the contract while making the odd glance to my new master above me. I was now a fart slave for Joeseph.
As soon as I signed the other two lads pulled the colour back into the sleeping bag. Where is one of them sat on my face, ripping farts, the other one put his cock in my mouth and forced me to take more of his cum, and then they switched the other one took over the farting duties, as I had to suck another cock and take more come.
My mouth was dripping. My face stank and my cock was harder than it ever been before. I was now fully a fart slave. I was Joeseph’s fast slave.
There was a story that I had reposted about a guy training his roommate to be his fart sniffer, but it got taken down sometime ago. Does anyone have it saved? It was probably my favorite fart fiction
Don’t be embarrassed. A fart fag is just what you are. You were born at the bottom, the very bottom haha. Now hurry up and plant your nose in my asshole, I’m holding a big one back so we can show the rest of the team how good I got you trained.
Part 2 : Drunk roommates having fun
“Duuude that went straight up his nose , it must’ve stunk so bad haha! I can even smell it up here!” Alvis laughed. “Hold on…I got some more haha” Lucas said as I once again felt his ready to rip asshole push against my nose. PFFFFFTTTTTH
"Dude I even felt some of the fart blow onto my hand, it’s that strong!” Alvis started laughing. "How'd you like that one buddy?" Lucas taunted me. “I kinda want to hear him beg..but hell we gotta keep him smelling these up hahaha!” Patrick couldn’t help himself but to start cracking up at the thought of it. “Oh, we're just getting started, my protein farts are basically endless” Lucas laughed.
I tried breathing through my mouth, but it was tightly sealed. I had no choice but to sniff up his farts... and even when I was holding my breath, it wouldn't make much of a difference since his gas was being blasted straight into my nose. With Alvis still holding my head in place, he ripped another big one.... then another... and another. All in the span of about 30 seconds. I felt like I was going to pass out; it was so bad.
I held my breath as he blasted another huge fart that lasted about 5 seconds. Right after it stopped, Lucas said, “Now if you take a big whiff, I'll let you go. Go on, let me hear you smell it."
I reluctantly did as I was told and inhaled loudly through my nose, getting the full effect of the last fart. It smelled terribly, but I just wanted this to finally end.
I started to gag and cough through the tape, and it made the guys howl with laughter. “Now we could let you go…or we could keep doing this all night hahaha!” Lucas laughed.
I started to squirm frantically, but they held me down unbothered. “I think he deserves another fart up his nose! Don’t you think Lucas?” Alvis smiled as he said. “I’m already there with you dude” Lucas said with a smirk.
PPPhhhhhrrrtttt A huge burst of air I felt against my nose. “Aahhh you like that? I call that silent but deadly. Oh, I feel another one. Get ready to start sniffing dude.” BBBbbrrppppttt. “Ahhh.” Lucas smiled as he said.
Fart after fart wrecked havoc on my poor nose, and all my roommates were doing was laughing. Enjoying my complete humiliation. Basking in the fact that they are the alpha males and I’m their fart bitch. Finally, Lucas spoke again, all the while releasing a soft stream of gas onto my face. It was warm, and I could feel it blowing into my nose. The stench was pure ass, like dirty sweaty man ass, and I began to gag.
“Inhale fag, and I’ll get off your face.” I let out a small whimper not wanting to inhale any of his gas willingly. “I said inhale! Or else your nose will be held against my sweaty crack tonight!” They all laughed.
Immediately following his statement, I began to inhale through my nose to the best of my ability. My willing nose was now bombarded with Lucas’s hot humid heavy farts. During this, I start to feel faint, but I can still manage to hear Lucas saying something along the lines of “Ahh yeah that’s right fag. No farts wasted. Sniff 'em up sissy” all the while Alvis and Patrick sound like hyenas around me.
“This is going straight into the football chat!” Alvis said as the recording ended due to a lack of storage. “Hey isn’t Coach Brawn in there too!?” Patrick suddenly realized.
“Haha it’s fine, knowing him he’ll love it” Alvis simply said as he shared it with the Snapchat group and watched for a moment as some of the guys in the chat started going wild laughing. Alvis then quickly deleted some apps without hesitation and went straight back to recording. I can’t miss any more farts! He thought.
“Sniff it up piggy!” “Oh yeah, get some of that” With my nose pressing into Lucas’s asshole, my eyes are still able to see up Lucas’s back. My eyes travel up it, looking at his muscles flex and shine with beads of sweat dripping down to conform in the middle of his backline, sliding down his crack and onto my nose. I look farther up his broad shoulders and see him looking back down at me as he grins. What an asshole! Lucas can’t help but smile as he can see Bert’s nose disappear into his crack, and his pleading eyes looking back up at him. Those eyes with tears falling from them over and over, his brow furrowed in suffering as he groans and whines trying to move his face out of his crack but failing to even slightly due to Alvis’s tight grip.
ALVIS POV
Alvis laughed once again as he stares at Lucas’s dirty hole plastered against Bert’s nostrils. He laughs as it pushes against his nose and opens up, letting out a stream of pure ass fart. Alvis grins even more when he gets an idea and puts down the camera for a moment. Using his now free hand, he pinches Bert’s nose.
“I got his nose, when you're ready to fart let me know and I’ll release it, forcing him to start rapidly inhaling. This way he’ll be sniffing at the perfect time and get the full amount of stink!”
“Hahaha yes dude good idea. Make sure his nostrils are in a good position too; we don’t want any of the fart going past his nose!” Lucas laughed as he said.
“For sure dude haha” Alvis said. After about 30 seconds he perked up and exclaimed “Okay, I think I got a big one, ready on three?” “Ready” “Okay, one…two…THREE!” Alvis unpinches his nose and immediately uses one finger to pull back on the top of its tip so that the nostrils are pulled back and fully exposed, then uses his other fingers to pull apart the two sides of Bert’s nose, to fully open his nostrils not only vertically but horizontally as well. Oh yea! You’re in for it now! Alvis couldn’t help but think in blissful anticipation.
BERT POV
Now I actually look like a pig with my nostrils stretched out as wide as they can. I thought the stink was bad before but now it's even worse. I’ve never felt so defenseless and defeated before in my entire life. I’ve never had my nose airway so widened before and now my sense of smell was increased seemingly twofold.
PTFFFFTTFFTFFFFFFF An intense blast of noxious fumes gusts itself continuously straight into my nasal cavity, as I desperately sniff trying to get any oxygen I can…but to my avail only sniffing in pure asshole and shit. I suck every last whiff into my nose as the fart lasts about 8 seconds (one of the biggest farts so far). “OH MY GOD DUDE! Did you hear him huffing it in!! BAHHAHA” Alvis can’t hold himself back from dying of laughter. “HAHAHAHA that must’ve smelled nice huh fag!” I can see Lucas grin down at me as I cry against his hole only to receive another sudden blast in my nostrils, me and Lucas making eye contact as I’m in disbelief. Why does he enjoy torturing me so much!? What did I do to deserve this?!
Come, faggot. You overcooked my ribeye and there are consequences in this house, my house. I let you live here because you serve and pay most of the rent but tonight you fucked up.
Peel off my dirty socks and wad them both in your mouth, yeah like that. Now get ‘em nice and clean in there and press your nose to my asshole. I’m gonna put this blanket over you, it’s getting cold outside and going to enjoy a nice long relaxing movie, just hope I don’t fall asleep PpppFfFFfTtttt….. ahhhhh. Breathe nice and deep, you are my fart filter too. As you breathe in my stench, think about how badly you fucked up tonight and how you’ll improve tomorrow. Cooking for me is an act of worship for your straight god of a roommate. PRrraaappappppttt…. Enjoy bitch.
Thanks to anonymous for commissioning me!
Smell of the undefeated
I can’t believe my boyfriend’s about to fight in an underground wrestling league. My boyfriend, David, has never wrestled in his life but is a huge fan of pro-wrestling. All David has going for him is that he’s fit.
We’re in a ring, located in the center of a supposedly abandoned warehouse, with hundreds of people in the stands surrounding us.
The reason this is held in a fake abandoned warehouse is because this league is illegal. Bets are openly taken for every match and a wrestler killing their opponent is fine. The staff will take care of the body after the match. And unfortunately we learned that David will be taking on the champion, and he’s known for killing rookies like David.
I’m standing on the outside of the ropes, next to David, who’s posted in the corner, resting against the turnbuckles with a cocky smirk.
“David, I don’t like the sound of this champion. They say he’s undefeated. Just quit now and let’s get outta here.” I plead to David.
David laughs, “Haha, relax Dylan, I got this. I’ve heard this guy’s a bottom-heavy bruiser. I’ll run circles around him, tire him out, and have him pinned in the next 5 minutes. I’m gonna be the next champion with you in my corner.” David boasts. Nice words but I still have a bad feeling.
Suddenly, music starts playing and the announcer’s voice fills the warehouse. “Ladies and gentlemen, for tonight’s main event we have the debut of our newest wrestler, David Quick.” David holds up his arms, smirking at the crowd, but he’s mostly getting booed.
“And here comes your undefeated champion. The toxic tormentor, the skunky sadist. NASH CHAMBER!”
The crowd goes wild and my eyes widen, as a 6’3 behemoth swaggers towards the ring. He’s wearing a gray, skin-tight wrestling singlet that shows off his Hulk-like muscles. Compared to him, David looks like a malnourished boy.
Chamber steps into the ring and holds up his arms as the crowd cheers wildly for him. As he does a small little circle, me and David’s jaws drop. From behind we see his enormous bubble butt. His singlet looks like it’s being stretched to their limit in containing Nash’s watermelon-sized butt cheeks.
David shakes his head, getting back into the game, and starts bouncing from foot-to-foot, warming up.
Once Chamber is done hyping up the crowd the two face off in the center of the ring. David holds up his fists looking determined. While Chamber stands with his hands on his hips, sporting a cocky grin.
The starting bell rings and David punches Chamber right in the chest. Chamber doesn’t even flinch, just keeps smiling. The crowd laughs at David’s weak punch, and I see David turning red with anger.
“David, keep your cool!” I yell, but he isn’t listening.
David dashes behind Chamber and cocks back his fist. That’s when I notice Chamber scrunching up his face.
Before David can punch Chamber in the back of the head…
BBBBBBBBBBRRRRRRRRRRRFFFFFFFFFFTTTTTTTTTT
Holy shit, Chamber just ripped a 10 second, thunderous fart that’s louder than the cheering crowd of hundreds. David is immediately stepping backwards, covering his nose with his hands and coughing.
I should hate seeing my boyfriend suffer but that’s one of the hottest things I’ve ever seen. I have a secret farting kink and I’ve never seen someone fart like that. Chamber looks over at me and gives me a sly smirk and a wink.
The announcer then comments, “Oh, Quick made the worst rookie mistake you can make. Never step in the blast zone of CHAMBER’S NOXIOUS BUTT-CANNON!” His shouts, making the crowd cheer even harder.
Chamber turns around and grabs David by the arm. He then throws him towards the ropes. David bounces off the ropes and is heading back to Chamber. Chamber turns around and jumps. David runs face-first into Chamber’s blubbery, aerial mounds. As soon as they make contact…
FFFFFFFHHHHHHHHHPPPPDDDDDD
Chamber actually clotheslines David with his gassy ass, knocking him to the ground.
David’s on his back, groaning. Chamber looks down at David, over his shoulder, with a mischievous grin. He then starts smacking his ass with both hands, making his meaty melons wobble.
The crowd then start screaming, “Geronimo, Geronimo, Geronimo”
“Uh-oh, I hope the rookie brought his umbrella because it looks like it’s about to start raining fat, farting asses!” The announcer calls.
Chambers pulls his legs out from beneath himself, and lets his bulbous backside crash onto David’s face. I wince at the sound of the impact. David weakly tries to push Chamber off of his face, but all he’s really doing is sinking his fingertips into Chamber’s quicksand-like ass fat.
Chamber curls his hands into fists, grits his teeth, and starts straining. PPPFFFFTTTT
Chamber rips a short but loud, warehouse-echoing poot in David’s face.
Chamber lifts his titanic rump a foot above David’s face, revealing it. David’s red-faced with teary eyes, and having a coughing fit.
Not even a second later, Chamber slams his big butt back on David’s face and poots again. He keeps doing this again and again on David’s face.
Up, Slam… RRRHHHHPPPP
Up, Slam… FFFFFDDDDBBB
Up, Slam… PPPVVVRRRRR
Up, Slam… BBBBWWWWFFF
Chamber does this for several minutes straight; demolishing my boyfriend’s face with his weaponized booty.
My boyfriend is getting destroyed by this farting monster and I’m more turned on than worried for his safety. Man, I’m an awful person.
Chamber finally stands up. With a cocky smirk, he reaches down, grabs David by the hair, and pulls him onto his knees. David looks miserable and defeated.
Chamber keeps his grip on David’s hair as he points to the turnbuckle. The crowd starts chanting, “Stinkface, Stinkface, Stinkface.”
Chamber drags David to the corner of the ring and lays him down so the back of David’s head is lying against the bottom turnbuckle.
Chamber then turns around, and then squats down, aligning his ass with David’s face. Holy shit, I remember watching pro-wrestling when I was younger, and seeing the superstar Rickishi doing this to his opponents.
“Oh yes ladies and gentlemen, here comes Chamber’s tried and true Stinkface. Let’s hope Quick has a sweet tooth because his face is about to be in a whole lot of cake.” The announcer jokes.
And with that, Chamber thrusts his hips back, smothering David’s face with his mountainous mounds of ass fat.
Chamber immediately starts wiping his bubbly ass from left to right, and up and down, all over David’s face.
Chamber’s eyes find me again and he gives me a wink and this time accompanies it with an air kiss. Fuck, this guy’s humiliating my boyfriend, he shouldn’t be turning me on.
Still wearing a cocky smirk, Chamber narrows his eyes in concentration before he starts lighting David’s face up with farts as he continues to Stinkface him.
PPPPPPFFFFFHHHHHHPPPPPP-FFFFFFFFWWWWWWWBBBBBBBDDDDDDD-RRRRRRRRRLLLLLLLLOOOOOOPPPPPPPP-BBBBBBBBRRRRRRRKKKKKKKKTTTTTTTTTTTT
Chamber unleashes a barrage of monstrous farts that can be heard over the crowd’s laughing and cheering.
After five minutes, Chamber finally gets off of David’s face. He throws both hands in the air, making the crowd cheer even harder for him. David looks half-dead, still resting against the bottom turnbuckle, barely moving.
Chamber pulls down the shoulder straps of his wrestling singlet, revealing his ripped upper body. He yells to the crowd, “Has he had enough?” before cupping a hand next to his ear, interacting with his fans.
“NO” the crowd cries. Then they start chanting, “Gas Him, Gas Him, Gas Him.”
With a wicked grin, Chamber gives a shrug. “Oh well, the people have spoken.” Chamber proceeds to pull his singlet completely off, now standing in the ring in only a gray jockstrap.
I’m both hard and scared as Chamber’s meaty moons pour out of their confines and bounce freely in the open. In big black letters, Chamber has a word tattooed on each butt cheek.
‘GAS’ is tattooed on his left buttcheek and ‘CHAMBER’ is tattooed on the right one.
Chamber cups his hands beneath both cheeks and starts jiggling them, making the crowd go wild.
“Uh-oh, it looks like the rookie’s headed straight for the Gas Chamber. Guess this is it for Quick. When the champ shoves someone into the Gas Chamber, they never come out alive.” The announcer explains.
Chamber walks back over to David and grabs him by the hair again. He drags David back to the center of the ring, on his knees.
David looks like a train wreck and is begging for mercy, but Chamber just ignores him. Chamber turns around, putting his bulbous, tattooed butt in David’s face.
With Chamber’s free hand, he reaches back and spreads open his globes before unceremoniously shoving David’s face into his toxic trench of an ass crack.
David’s face rapidly sinks into Chamber’s deep, voracious ass. Chamber’s pushy hand and swiveling hips work in tandem to bury David even deeper into the Gas Chamber.
Finally, Chamber lets go of his buttcheek. Chamber’s thick globes wrap around David’s head and make contact with each other. I’m horny/horrified by David’s entire head being completely entombed in Chamber’s gargantuan rump, with the words ‘Gas’ and ‘Chamber’ side-by-side.
“Quick’s locked up in the Gas Chamber and the champ looks like he’s raring to go. The longest someone’s survived in the Gas Chamber is three minutes. Let’s hope this lousy rookie can at least set a new record.” the announcer comments.
Chamber bends his knees slightly, and curls his hands into fists. He then closes his eyes and grits his teeth, and then starts grunting and straining.
BBBBBBRRRRRRFFFFFFFTTTTTTTT
PPPPPPPPPHHHHHHHHVVVVVVVBBBBBBBBBBB
DDDDDDDDMMMMMMMMMBBBBBBBRRRRRRRRR
FFFFFFFFFFFLLLLLLLLLLLDDDDDDDDMMMMMMMM
RRRRRRRRRRKKKKKKKKKOOOOOOOOBBBBBBBBB
Chamber is a machine. He keeps ripping monstrous farts that last from 10-15 seconds, pointblank in David’s face. Even with the cheering crowd and David’s face in front of his asshole, Chamber’s farts can still be heard all around the warehouse.
David was already weak in the beginning but his flailing limbs are looking weaker by the second. I try for Chamber’s attention before it’s too late.
“Wait, please stop!” I cry.
Chamber opens his eyes and looks at me. A cocky smirk forms on his face but his farting has paused for the moment.
“Oh, looks like Quick’s boyfriend is trying to plead to Chamber to spare him.” The announcer observes.
Chamber flexes his glutes, trapping David’s head as he walks up to me, dragging a crawling David behind him.
“Please let him go, he’s already lost.” I beg when Chamber is standing in front of me.
“Sorry bud, but when I put someone in the Gas Chamber, they’re done with their living. Why should I make an exception for this loser?” Chamber asks with a smarmy grin.
“Please don’t, I-I’ll give you anything.”
“Hmm, anything you say? Well for me to even consider letting this loser live, I’m gonna need an incentive. How about a kiss on the lips and then we’ll talk?” Chamber suggests shocking me into silence.
To get the ball rolling again, Chamber closes one eye and grunts, ripping a squeaky fart in David’s face. “Ah, you better hurry before your chump suffocates in the Gas Chamber.”
I surge forward and plant my lips on his, kissing him. Wolf-whistling and cat calls erupt from the crowd.
I pull my lips from his, blushing. I can’t deny that, that was an amazing kiss.
“Alright then, here’s the deal: to get him out you’re gonna have to take his place in the Gas Chamber.” Chamber says, making me choke on my spit.
“But not now. You’re gonna wait around, out here, after this match and everyone leaves. I’m gonna come back out into this ring and you’re gonna willingly bury your face in my Gas Chamber. Agree to this and I’ll let your loser-of-a-boyfriend live.”
I’m blindsided, not knowing what to say.
“Do we have a deal? Or am I sending this loser to the afterlife?” Chamber cocks his left leg and rips a greasy fart, further torturing my Gas Chambered boyfriend.
I audibly swallow, nervous about this arrangement. I nod my head and say, “Yes”.
“Great, let’s get your boy-toy out of my Gas Chamber, shall we?” Chamber reaches back with both hands and spreads open his bubbly cheeks, revealing the back of David’s head. Chamber grits his teeth, scrunches up his face, and starts grunting and straining.
BBBBBBBBBBBRRRRRRRRRRRRRAAAAAAAAAMMMMMMMMMMPPPPPPPPPTTTTTTTTTTTTTT
A roaring, thunderous fart, that has the entire ring quaking, explodes out of Chamber’s ass. David’s launched out of the Gas Chamber, and lands on the ring floor, on his back, dry-heaving.
The crowd starts booing and the announcer voices his annoyance.
“What the hell is this? Why is our champion letting someone out of the Gas Chamber alive? It looks like Chamber is going soft.” The announcer complains.
Chamber narrows his eyes and glares murderously at the announcer who’s standing just outside of the ring, with a microphone, looking towards the crowd. Chamber stomps toward him. I can’t help but stare as the mounds of his Gas Chamber bounce and clap against each other with every step.
Chamber reaches through the ropes, grabs the screaming announcer by the hair, and pulls him into the ring. Chamber forces the announcer to his knees and takes the microphone away from him.
“So ya’ll won’t be happy unless I leave a corpse in the ring, huh? Then so be it.” Chamber addresses the crowd and then looks down at the announcer with a devilish grin. “And since you agree with them, I’m sure these last few minutes of your life will put a smile on your face. Into the Gas Chamber with you.”
Chamber wheels around, putting his fat, tattooed globes right in the frightened announcer’s face. Chamber reaches back, spreading his cheeks with his free hand. He then carelessly pulls the screaming man’s face into the Gas Chamber.
I watch as another victim’s entire head is consumed by Chamber’s enormous ass.
The crowd’s cheering again and starts chanting, “Gas Him, Gas Him, Gas Him”
Chamber widens his stance, curls his hands into fists, and grits his teeth.
PPPPPPPPPPPPPPPLLLLLLLLLLLLLLLLLWWWWWWWWWWWWWWWRRRRRRRRRRRRROOOOOOOOOOOOOOHHHHHHHHHHHHHHHFFFFFFFFFFFFFFTTTTTTTTTTTTTTTTTVVVVVVVVVVVVVVVVVVVLLLLLLLLLLLLLLLLLMMMMMMMMMMMMMMMMMMMMDDDDDDDDDDDDDDDDDDDDDDD
An ungodly fart roars out of Chamber’s ass and into the announcer’s face for 5 minutes straight. This behemoth-of-a-fart doesn’t seem humanly possible. Me and others nearby have to cover our ears from how loud it is. And as I look around I see a slightly brown tint in the air.
2 minutes into the monstrous fart, and I see the announcer’s struggling body go limp, but that doesn’t stop Chamber.
Once this massive leviathan-of-a-fart comes to an end, Chamber pulls the guy out of the Gas Chamber and lets his body fall to the ground.
Another announcer runs out from the back and slides into the ring. He takes the microphone and lifts Chamber’s hand into the air. “And here is your undefeated champion: NASH CHAMBER!”
And the crowd goes wild for him. Chamber swaggers up to me with a cocky grin. “Don’t forget the deal.” He reminds me.
“I-I won’t” I reply. Chamber gives me another wink and heads backstage. People come out to help David and deal with the announcer’s body. As the rest of the crowd leaves, I wait just outside the ring.
I’ve been pacing for the last 15 minutes when David comes out from backstage. I smile as I try to give him a hug, but he steps back, out of reach.
“I’m sorry Dylan but we’re over. And I’m leaving the city. Nash ordered me to do this or he’d put me back in the Gas Chamber. And this time no one would be able to save me.” With that David just leaves.
I feel empty as I watch him leave. This monster cost me my boyfriend and now he’s about to destroy me. The only silver lining is that he’s gonna fart in my face.
A few minutes later, the place is eerily deserted, and Chamber comes back out from backstage. He’s still only wearing a gray jockstrap
As we both get into the ring, Chamber starts to speak. “You know, wrestling as long as I have, you learn to read people both inside and outside the ring. The moment my eyes landed on you I knew what you were. Heh, when I first farted in my match, you were blushing like an untouched virgin.”
It’s frightening how perceptive he is.
“I immediately knew that I had to make you mine. That loser Quick doesn’t deserve you. No, you deserve to accompany a winner like me to the ring.”
My eyes widen; Chamber is still smirking.
“Tell me you don’t want me to fart on you, tell me you don’t want to stick your face in the Gas Chamber. Tell me and you can go. I won’t stop you.”
I look down at his lips, unable to look him in the eyes. Unable to confess the truth.
A wolfish grin forms on his lips. Chamber walks up to me and then spins around and presses his bare ass against my lower midsection.
PPPPPPRRRRBBBBTTTTT
I feel his warm butt air venting against me. The stench of rotten eggs and broccoli reaches my nose. My breathing is becoming faster.
Chamber looks back at me, over his shoulder, with a knowing grin. “I know a fart-sniffer when I see one. Stop fighting it. Beg me to fart on you. Beg me to put you in the Gas Chamber.”
I can’t do it.
Chamber suddenly grabs me and quickly but gently takes me to the ground. With experienced maneuvering, I find myself in a reverse head-scissor hold. My head’s trapped between his muscular thighs with his tattooed bubble butt right in my face.
He flexes ‘Gas’ and ‘Chamber’, and once he relaxes them…
BBBBBBRRRRRRRHHHHPPPPPPPP
He blasts me with a loud butt bomb that trumpets throughout the warehouse, my face being in its way be damned. His sulfuric, nose hair-singeing fumes are nauseatingly amazing.
After a few moments of no more farts, I glance up, over Chamber’s fleshy hillside-mounds, and see him peering back at me with a cheeky grin.
Why isn’t he farting anymore? Then I remember his words.
I bring my hands up and start running them all over his rotund, fat-coated globes.I love the feel of his butt-blubber pouring through the gaps of my fingers.
With his ass fat nearly covering my mouth, I beg, “Please fart in my face.”
“Aw such manners. Now there’s a good fart-sniffer. Enjoy… NGH”
FFFFFFFFFWWWWWWWWWRRRRRRRRAAAAPPPPPPP
A typhoon of hot, sulfuric ass wind flies up my nose and I love it. Chamber tightens his quads around my head, pulling me in and smothering my face against his pillowy yet firm buttcheeks.
Chamber starts swiveling his hips, rubbing his bare bum all over my face while unleashing a category 5 fart storm.
BBBBBBBBBRRRRRRRRRRWWWWWWWPPPPP
“Yeah that’s it. Kiss it!”
RRRRRRRRRMMMMMMMMMOOOOOOOOOBBBBBBB
“Taste it!”
PPPPPPPPPPLLLLLLLLLLL-HHHHHHHHHDDDDDDDD
“Show it the love it deserves!”
RRRRRRRRRRRAAAAAAAAAAKKKKKKKKKPPPPPPPP
“Worship my nasty, unbeatable booty!”
FFFFFFFFFFRRRRRRRRRROOOOOOOOPPPPPPPPP
DDDDDDDDDHHHHHHHHHHHAAAAAAAABBBBBBBB
FFFFFFFFFFFFWWWWWWWWWUUUUUUUMMMMMMMM
Spurred on by his words and huffing up all his noxious ass gas, I start peppering his meaty globes with kisses, and licking the sweat trickling from his ass crack.
This is too much, I feel like I’m about to shoot. My body’s starting to shake.
“Whoa-whoa, let’s pump the brakes. We don’t want the fun to end too soon.” Chamber says as he frees me from his head-scissor and rolls me onto my back, before lying his enormous self on top of me, making me groan.
“Here, maybe this’ll cool you down.” He continues with an arched eyebrow.
Chamber lifts up his arm and plants his sweaty armpit on my face. He then starts wiping his armpit from left to right, drenching my face in his musky sweat.
Even though I’m loving this too, it does surprisingly start to cool me down. So caught up, I don’t even realize that I’m licking Chamber’s sweaty pit until he jumps off of me and growls. “You’re fucking insatiable, I can’t take it any more. It’s time to put you in the Gas Chamber.”
Something sounding so foreboding shouldn’t sound so hot.
Chamber stands up and faces away from me. I get onto my knees and come face-to-face with his thick cakes. The words ‘GAS’ and ‘CHAMBER’ are right before my eyes.
Unable to resist, I bring my face towards his ass but he takes a step forward, putting distance between us. “Beg” He growls, huskily.
“Please put me in the Gas Chamber. I’ve never wanted anything more.” I beg.
Chamber reaches back with both hands and spreads open his beefy slabs, revealing his asshole.
I follow his silent command, diving my face in between his imprisoning cheeks; pressing my nose and lips against his asshole.
Chamber lets go of his cheeks, entombing my entire head in his Gas Chamber.
“There you go, nice and trapped in my Gas Chamber, with no way to escape… FGH”
FFFFFFRRRRRRRRRRWWWWWWBBBBBBBB
I take a 9 second, eggy fart, right up the nose. So turned on by his raunchy ass fumes, I start licking his winking, sweaty pucker. Chamber moans above me.
“Oh fuck yeah. Eat my nasty, butt-bombing hole you crazy fucker” RRHHBBRR “Eat this too while you’re at it” BBWWTTDD “Yeah keep that throat open, I’m dropping another air biscuit down your gullet” FFMMOOHT “Fuck yeah, you’re a perfect, willing fart-sniffer” RRFFVVBBB “Gonna get you addicted to my stinky ass gas” PPWWLLAB “Make sure you’re in my bed every night” FFHHTSTSSS “Begging me to lock your face in my Gas Chamber” BBBBRRRRR-MMMMMOOOOO-DDDDTTTTTT
“Damn, you’ve been locked up in the Gas Chamber for 7 minutes and you’re still frenching with my hole like some love-sick teenager. As soon as I trap someone in there, they’re already trying to escape, but not you. Let’s see if this big fella heading your way will fix that. Oh well, it’s not like it really matters. No one escapes the Gas Chamber… NGH”
BBBBBBBBBBBBBRRRRRRRRRRRRRRAAAAAAAAAAAAAAMMMMMMMMMMMMMMPPPPPPPPPPPPPPPOOOOOOOOOOOOOOOOOOVVVVVVVVVVVVVVVVVVHHHHHHHHHHHHHHHHDDDDDDDDDDDDDDDDDDDDDTTTTTTTTTTTTTssssssssssssssss
Chamber unleashes another one of his inhumanely loud and long farts, right in my face. I take in deep breaths, torturing my lungs with his digested meat and onion smelling fumes. Even for a fart lover like me, it’s too much and I pass out halfway through. Right after I shoot my load in my boxers.
I groan as I come to. My face repeatedly bumping against something soft yet firm, awakens me. I open my eyes and right in my face is Chamber’s fat ass in a pair of black, form-fitting compression shorts. I’m slung over his shoulder and we’re walking through the deserted parking lot.
“What’s happening? Where are we going?” I ask, groggily.
“Heh, don’t you remember? You’re mine now. We’re heading back to my place. Why don’t you get some more sleep? When you wake up you’ll be in my bed and your handsome mug will be heading back into my Gas Chamber. Deep huffs fart-sniffer.”
Chamber pauses in the middle of the parking lot and hikes up his left leg with my upside-down face in front of his bubble butt.
FFFFFFFFLLLLLLLLLLLHHHHHHHHHHHHHOOOOOOOOOOOPPPPPPPPPP
Smell of the x gene
In this story mutants and the X-men exist. Also the final part of this story gets rather explicit.
It’s Valentine’s day but me and Austin, my boyfriend of 4 years, are just going to have a chill day this Saturday with the long week we endured. First we bought a house and we’ve been spending most of the week moving. And then, just yesterday I found out that Austin’s been keeping a huge secret from me for four years. He’s a mutant.
Yesterday morning I woke up and found two Austins in my bed. His mutant power is that he can make numerous duplicates of himself. At first I was livid but it quickly subsided when he told me that he was scared that I’d hate him for being a mutant. I could understand that. There are a lot of groups who want the entire mutant population dead. I immediately quelled Austin’s fear by telling him that I still love him and I think his mutant power is awesome. I also told him I’m a huge fan of the X-men and they do great work.
This morning, I wake up to the smell of eggs and bacon. I make my way into the kitchen and find Austin cooking. I shake my head in wonder as three sexy Austins are cooking. One’s frying eggs on a pan, one’s defrosting bacon in the microwave, and the last is cutting up some fruit. All their backs are to me and they’re only wearing a pair of black underwear. My eyes are zoned in on the Austins’ fat, bubbly ass cheeks as they bounce and flex as they work. Austin’s handsome, tall, muscular, and has an insanely fat butt.
The three Austins turn around and notice me with smiles. They walk up to me together. The two flanking the middle Austin melt into him, leaving me with the original Austin. He gives me a kiss and then we set up breakfast at the dining-room table.
While eating Austin smiles and says, “Ron, it’s Valentine’s day and I got something special planned for you.”
I frown, “Austin with the whole move, we promised no Valentine’s gifts.”
“Yeah, but what I’m going to give you doesn’t cost any money. Now that you know about my mutant ability, I thought we could have a lot of fun with it, all today.” With a smirk, Austin cocks his leg and…
PPPPPPGGGGHHHHTTTTT
Austin farts and I can feel my face turning red. One thing that really brought us together is our shared farting kink. To be more precise: I love getting farted on and Austin loves farting on me. And time and time again Austin’s proved that he’s that gassiest man alive. He’s always farting, especially around me.
Austin stands up, rounds the table, and his voice becomes husky. “Happy Valentine’s day Ron. Me and my clones are going to be farting all over your body today. Not a single inch of your body will be safe from my butt stink.” Austin says as he takes my hands into his and stands me up.
“A-are your clones gassy as you are?” I ask with an obvious hard-on.
Austin cockily smirks without saying a word. Austin’s body then ripples and a duplicate of his slides out of him, and it steps around me. I then feel him back his thick rump against my lower back.
Austin’s clone then says, “Does this answer your question.” and then farts on me. I gasp, feeling the warm, heated air venting against my lower back. The clone sighs in relief and starts rubbing his ass against me, grinding the stench in.
I moan as Austin Prime (what I like to call the original Austin) brushes his hand over my hard-on in my boxers. “Oh yeah baby, I’m trapping you in a vicious cycle. Me and my clones are going to be farting on you again and again and again, and I’m gonna make you shoot your load again and again and again, until you’re shooting blanks.”
Prime Austin then looks at his clone, over my shoulder. “You know, I think we need to convince him that you guys can fart like me. He’s felt the power of your butt bomb against him but now he needs to smell it.”
“Heh, you’re right! Why don’t you stick his face on in there. This next one has his face’s name on it.”
Prime Austin spins me around and then shoves me to my knees. I fall to my knees and am face-to-face with clone Austin’s bulbous backside. I then feel Prime Austin grab the back of my head and shoves me face-first into his clone’s ass, smothering my face with his doughy ass-mounds.
As soon as my face is buried in his ass… FFFFRRRRRRTTTTTTTT MMMMMMLLLLLLLPPPPPP. Clone Austin rips two airy farts, back-to-back, in my face that reek of rotten eggs and garlic.
“Oh yeah, I trust he won’t be doubting us clones’ farting abilities after huffing up that bad boy.” Austin’s clone quips.
“True, but let’s give him a taste of the original’s butt fumes so he can compare and be 100 percent certain.” Prime Austin adds.
With that the two switch and now clone Austin’s holding the back of my head and Prime Austin’s fat, bubble butt is right in my face. My face is once again shoved against a pair of underwear-clad, basketball-sized butt cheeks.
“Happy Valentine’s day my sweet. It isn’t chocolate but I’m sure you’re going to love gobbling this down”
FFFFFFFFFFFFHHHHHHHHHHHHLLLLLLLLLLLLLPPPPPPPPPPPPPP
Prime Austin rips a long, trumpeting fart pointblank in my face. It smells just as bad as his clone’s fart. It has me gagging and coughing and I love it.
“Ah, that felt good” Prime Austin starts as he wiggles his ass all around my face. “But let me show you something else. Something you’ll be experiencing daily, when we’re alone.”
Clone Austin releases the back of my head but before I can even think of pulling my face out of Prime Austin’s ass, something big and both firm and fleshy presses against the back of my head, keeping my face trapped against Prime Austin’s ass. I instantly realize it’s clone Austin’s ass pressing against the back of my head, especially as I feel his doughy cheeks pour around the sides and make contact with Prime Austin’s cheeks, completely entombing my head in all of this Austin ass fat.
“Welcome Ron to your first of many stays in my Cake Prison. Don’t let the name fool you, this’ll be anything but sweet… NGH”
PPPPPPPPPWWWWWWWWTTTTTTTT-RRRRRRRRRLLLLLLLLLMMMMM-FFFFFFFFFVVVVVVVHHHHHHH-PPPPPPPUUUUUUUUUKKKKKKKKKK-BBBBBBBBBBBBBDDDDDDDDDDDDFFFFFFFFF-VVVVVVVVVVWWWWWWWWWDDDDDDDDDDDD
The back and front of my head are on the receiving ends of Austin’s farts. It’s like their big asses are having a heated conversation and my head’s stuck in the middle. I’m trapped in a sulfuric vortex of their combined farts and it’s overwhelming. Without touching myself, I cum before passing out from this intense experience.
LATER
PPPFFFTT. I’m jolted awake with a poot to the face and find Austin’s meaty rump, confined in his form-fitting underwear, right in my face. Austin straightens up and turns around, and I notice that I’m sitting on the couch.
My eyes widen as I take in the five Austin’s, including Prime Austin, standing in front of me. They’re all smirking down at me.
The middle one, who I assume is Prime Austin, speaks. “Sorry to wake you up babe but you’ve been asleep for an hour and I have a game I want to play with you. And if you win this game we’ll have some more gassy fun. But if you lose” One of his clones hands him a teddy bear, “If you lose then you have to sit back and watch as this bear gets to enjoy our gassy techniques.” With a lopsided grin, Prime Austin holds the bear against his ass and scrunches up his face in an exaggerated manner.
PPPHHHHFFFFF-PPPPWWWPPP
He hands the bear off to his clones and the four each take turns farting on it.
I lick my dry lips and ask, “Okay so what’s this game?”
“I call it ‘What did Austin eat?’. While you were unconscious the five of us ate five different things. Each of us is going to fart in your face and you have to guess what that Austin ate. If you guess at least 3 out of 5 correctly, you win. Any less and you lose. Are you ready to play?” Prime Austin asks with a cheeky grin.
I nod my head, determined to win. “I’m ready.”
The Austin on the far left walks up to me, spins around, and bends over, extending his beefy ass into my face.
BBBBBHHHHHHHHDDDDD
An airy fart that stinks of digested meat and cheese blows over my face.
“A slice of leftover pizza” I call out immediately.
“You got it,“ the clone congratulates. Suddenly he reaches back and grabs the top of my head. Then he pulls my face into his ass and… PPPFFTTT.
He sighs in relief before walking away and then another clone’s bubble butt is in my face.
Ffffffffftststsstsss
A small wet fart, that only stinks of Austin’s ass musk, hits my nose, baffling me.
“Uh, bacon” I guess.
“Oh sorry love, that was a pop tart.” The clone straightens up and presents to me his side profile as he takes the teddy bear from Prime Austin. He looks at me as he presses the bear against his ass, cocks his leg, and closes one eye. RRRRLLLLLLLLDDDDD
Never thought I’d be jealous of an inanimate object.
The third clone backs his fat rear into my face.
BBBBBB-FFFFF-PPPPPP
This one sounds like a machine gun and smells of rotten eggs.
“Oh, uh the eggs from earlier.” I answer.
“We’ve got a winner” This one reaches back, takes my hands into his and pulls me forward. I’m jolted forward and my nose is planted in between his butt cheeks. TTTTTTTHHHHHHBBBBB
The fourth one steps up and points his pillowy rump in my face.
PPPPPPLLLLLLLWWWWWWDDDDD
He rips a trumpeting fart in my face that kinda smells like rotten fish.
“Um, cod?” I take a shot in the dark.
“Oh, sorry love, what you’re smelling is the protein bar I had.” The clone spins around, bends at the knees, and sticks his ass out, in the opposite direction of me. Prime Austin, who’s holding the bear, presses it against the clone’s ass. The clone grunts and… FFFGGGGGPPPPPPP
It’s finally Prime Austin’s turn. He turns around and backs his meaty butt up until my nose is within 2 inches of his crack.
“Sweety, you’ve got to answer what I had correctly if you want to win. Here let me help you out. Why don’t I make sure there’s nothing in the way of my glorious butt fumes to your nose.”
Prime Austin pulls down the back of his underwear and his plump, fuzzy ass-mounds spill out into the open and bounce in front of my eyes. He then spreads his cheeks revealing his fur-surrounded pucker. I watch his hole open up, then a stream of ass wind silently flows out and into my face.
I instantly start gagging on the sbd that stinks of rancid beef and raw sewage.
“Oh, unfair Austin! You gotta warn me before you eat supreme tacos from Taco Bell and fart in my face! You know that!” I gripe at him.
Austin’s ample globes jiggle from his laughter. “Hehe, sorry about that babe, but hey, you got it right. You’ve won Ron and now here’s your prize.” he says as he pulls his underwear back up.
Suddenly I’m pulled off the couch and put on my knees. All five Austin surround me and then spin around. My head is now surrounded by an impenetrable ring of their fat bums that are cheek-to-cheek. There’s only a few inches from me and any of the asses.
“Welcome to my fartagon Ron, my smelly interpretation of a pentagon. My family’s full of mutants so they know about my power. Because of that, my little brother and cousins have a lot of experience with my fartagon. And now you’ll become a regular in here as well.”
All the Austins lean forward and put their hands on their knees, pushing their fat asses out. My head is instantly pressed against from all sides, trapping me.
“Alright gentlemen, this is for my handsome Valentine. Let ‘em fly… NGH”
PPPPHHHBBBBBBTTTTTTTT, FFFFFFWWWWWWPGGG, BBBBBBBBHHHHHHHWWWRRRRRR, PPPPPPPPRLLLLLDDDDDDD, FFFFVVVVVVUUUUUBBB, BBBBBBBBHHHHHHTTTTTFFFFFF, PPPPPPUUUUUUUDDDDDDBBB, RRRRRWWWWWWLLLTTTTT, GGGGPPPPPBBBTTTTT, FFFFFFVVVVVV-TSTSTSTSTSSS
My head is met with a variety of different-sounding farts coming from all directions. It’s like I’m trapped in a putrid hurricane made of every type of stench Austin’s ass is capable of. Every inch of my head keeps receiving one fart after another.
It’s too much and I’m once again, cumming hands-free. I blissfully pass-out in Austin’s fartagon.
LATER
I come to, feeling myself being lifted up, bridal style, in muscular arms. I open my eyes and Austin’s looking down at me with a lopsided grin. We’re still in the living-room.
I’m about to ask ‘how long was I out?’ but I’m stopped by the sound of multiple Austin farts being ripped simultaneously. And none came from Prime Austin who’s holding me.
I look around and see one or two Austin clones in every visible room, farting on any and everything.
In the living-room with us, an Austin clone is picking-up our framed pictures on the end tables and farting on them.
In the dining-room, a clone is sitting in every chair and ripping a fart. And another clone is sliding across the top of the dining-room table, on his knees, farting as he slides along.
In the kitchen I spot an Austin clone opening the microwave and farting in it. Next, he opens the silverware drawer and farts in it. And then he opens the fridge, turns around, and sticks his butt into it, to my shock and horror. The clone catches me watching and gives me a smirk and a wink. Then he scrunches up his face and rips a tuba-sounding fart that ends on a wet note, butt bombing our food.
Prime Austin snickers and starts carrying me somewhere. “Come on my cute Ronnie. I have something planned for you in the bedroom that you’re gonna love. And ignore all this, me and my clones are just making sure that our new home smells like your favorite place. My ass! Haha”
As Austin carries me to the master bedroom, I watch as his horde of clones swarm throughout the house, farting on everything.
We pass the bathroom and an Austin clone is standing in the middle of the room, leg cocked, and ripping a juicy fart.
“What the hell are you doing?” Prime Austin calls out, annoyed. “Turn on the shower and fill the room with steam. That’ll help our farts stink up this room much worse.”
The clone slaps his own forehead. “Of course, what was I thinking?” he admonishes himself.
Prime Austin walks up to him and says, “Are you trying to ruin my Ronnie’s smelly Valentines? Here, I think you should make it up to him, show him you’re sorry.” Prime Austin’s wearing an impish grin as he mock chastises him.
When Prime Austin’s in front of the clone he squats, with me in his arms, lowering my face to the level of the clone’s waist. With a sly grin the clone says, “Sorry Ron, please take a whiff of my forgiveness.” he then spins around, backs up, and plants his meaty rump on my face.
PPPHHHHHRRR. He rips an eggy fart in my face that has me gagging. Both Austin’s are laughing as Prime Austin carries me out of the bathroom. Just as we leave I hear the shower being turned on and then… RRRRLLLLBBBBTTTT.
We enter our bedroom and find a single clone in here, standing next to the bed. He has my pillow pressed against his ass and is ripping a series of squeaky short poots.
When the clone notices us, he smiles and lets my pillow fall to the floor. He then pulls down his underwear, and Austin’s hard and thick 7.5 inches springs out.
Austin’s clone flings himself onto the middle of the bed, on his stomach, facing the headboard, in a spread eagle position. I nearly swoon from clone Austin’s fat, bare globes jiggling and clapping against each other as he lands on the bed.
Prime Austin then stands me at the foot of the bed, having me face his naked clone. Prime Austin then covers my back with his chest and I feel his raging hard-on against the cleft of my ass.
Prime Austin yanks down my boxers and gives my bare ass a smack, making me yelp. He then growls in my ear. “I hope you’re still prepped from last night because it’s time for a…” Prime Austin accompanies every one of his next words with a forceful hump. “Hard… Smelly… Valentine’s Day Fuck!”
Prime Austin suddenly grabs the back of my head and shoves my face down onto the bed. My face is headed straight for his clone’s bulbous backside, and that’s where it lands. I find my face wedged deep in between clone Austin’s pillowy mounds.
I’m now bent over the bed with the upper half of my body draped on the bed and my feet still on the floor.
I can’t see a thing but I hear Prime Austin pulling down his underwear, then the cap of a bottle popping open, then the wet sound of Prime Austin lathering himself.
We both moan as Austin slowly but surely drives his over 7 inches of meat into me.
We’re both panting once he’s fully sheathed inside of me. Prime Austin grabs my hand, pulls it back, and presses my palm against his fuzzy abdomen. I feel a lot of aggressive bubbling and churning going on in his stomach.
“Mmm, you feel that love? My rear thrusters are raring to go.” Prime Austin coos.
Rear thrusters is what Austin calls it when he farts as he fucks me. He brags that his farts give him more power as he thrusts inside me.
Austin slides his dick halfway out and as he thrusts back in… BBBHHHRRRRPPPP.
Pull out… Thrust… FFFFFFFLLLLLPPPPPP
Pull out… Thrust… BBBBBBBDDDDDDDPPPPPP
Pull out… Thrust… RRRRRRRPPPPPPPPPMMMMMM
While still fucking me, Prime Austin reaches forward and smacks his clone’s bubble butt, making his blubbery globes ripple around my consumed face. Because of that action, my face sinks down further and I feel my lips kissing his pucker.
“You’re up, gift my Valentine something good.” Prime Austin orders.
Austin’s clone then calls out, “Say ah Ronnie, here comes some digested-chocolate farts. Some sweets for my sweet… FGH” RRRRRHHHHHLLLLLRRRRR
BBBBPPPPFFFFF, MMMMMMLLLLLDDDD, HHHHFFFFFPPPPP, BBBBVVVVVVVMMMM, FFFFFFFKKKKKKWWWWW, RRRRRRRUUUUUUUFFFFFFF
Both Austins are non-stop farting machines. Clone Austin keeps blasting my face with his spoiled milk smelling farts and Prime Austin keeps farting as he fucks me, filling the room with his butt fumes.
Prime Austin picks up speed, and it feels like we’re both about to shoot. Just as I’m about to, Austin stops. Suddenly Prime Austin’s pulling my face out of his clone’s ass and flipping me onto my back. The back of my head is now using the clone’s plump ass as a pillow and Prime Austin has my legs tossed onto his shoulders.
I blink rapidly, my eyes getting re-used to the light. I gawk at what I’m now seeing. Prime Austin is sweaty but looking down at me with a smirk. 6 clones of Austin, also naked, surround the bed, all smirking as well.
One of the clones climbs into the bed, and over me. He turns around, straddles my shoulders, with his ample ass-mounds hovering a foot above my face. Through his legs, I see Prime Austin with the same impish smirk.
“Just think Ronnie, two days ago you could barely deal with my single big ole booty. But from now on, I’m gonna be overwhelming you with several of them at once. Happy Valentine’s day baby.”
With that the Austin clone takes a seat on my face, smothering me and Cake Prisoning my head in between, well two thick Austin cakes.
Once again I’m sealed in complete darkness.
I grunt as another clone climbs onto me, and sits on my stomach. Then two more climb in and take seats on the middle of each arm, pinning them to the bed. The last two stand by either side of the bed. I feel them take my hands and wedge them into their butt cracks.
Prime Austin starts pounding me again, and farting with every invading thrust. “So fucking good” I hear him moan, mostly to himself.
“Alright my Austins, let’s make my sexy Valentine a happy boy. Don’t stop farting until he and the entire house reeks of my butt bombs… HGH”
FART * FART * FART * FART * FART * FART
“Ah, you know what? Scratch that. Don’t stop farting until him and the entire block reeks of my butt bombs… NGH”
FART * FART * FART * FART *FART * FART
“Oh, fuck it! Happy Valentine’s day Ronnie. Just for you I’m gonna make fresh air go extinct. From now on, all the air we breathe on this planet will stink of my farts. Let ‘em blow gentlemen, show my love no mercy… UGH”
BBBBHHHHHHLLLLLLLLLMMMMMMMMMM
FFFFFFFFFVVVVVVVVVVBBBBBBBRRRRRRR
PPPPPPPPWWWWWWWWWWWGGGGGDDDDDDD
DDDDDDDDDBBBBBBBBBBBRRRRRRTTTTTTTTTT
PPPPPPPPPPRRRRRRRRRROOOOOOOHHHHHHHHH
BBBBBBBBBBHHHHHHHHHHHHRRRRRRRRRRRRAAAAAAAAAAMMMMMMMMMMVVVVVVVVVVVVVPPPPPPPPPPOOOOOOOOOOBBBBBBBBBBBBBB
Smell of his bad side
For our high-school senior trip we’re staying at this world-class, ocean-side resort for the weekend. Unfortunately, when we arrive, I find myself rooming with two other guys I don’t know all that well, instead of my friends. The first guy’s Cullen. He’s a soccer player, the nicest person you could ever meet, and I have a secret crush on him . Thanks to being an athlete, he’s muscular but he also has an insanely fat ass. Today he’s wearing a blue polo shirt, and a pair of gray shorts that accentuate his melon-sized butt cheeks. I’m definitely not mad about rooming with him.
My other roommate is a different story. Todd is a lithe guy who’s a brat thanks to having rich parents. The three of us are now in our room and Todd is throwing a fit.
“How dare they pair me with you two; I should have my own room! Don’t they know who my father is?” he seethes.
The room is big with two beds and a couch. “Look man, I’ll take the couch, you can have a bed, and Cullen can take the other.” I try to placate him.
Todd sneers at me. “That’s not the point you idiot. The point is that I should have my own room; I shouldn’t have to be rooming with you two peasants.”
I frown at that. Peasants? Who still uses the word peasant?
“Calm down man, he’s just trying to help” Cullen defends me.
Todd turns his ire towards Cullen. “Oh shut up and stay out of this you fat-assed neanderthal.”
Todd’s tantrum is pushed to the back of my mind as I see something I’ve never seen before. Good-guy Cullen looks pissed. His eyes, full of hatred, are locked on Todd.
Cullen gets right up in Todd’s face. “Call me that again and see what happens.” Cullen threatens.
With no sense of self-preservation, Todd smirks and says, “We both know you’re not going to touch me, you fat-assed neanderthal.”
Both of Cullen’s hands shoot up and wrap around Todd’s slender neck. Todd’s eyes bug out and Cullen starts backing him towards the bed. When the back of Todd’s legs touches the bed, Cullen shoves Todd to his knees. Cullen then positions Todd’s head so it’s lying on the edge of the bed, face up. Todd’s too stunned to resist, which works out for Cullen.
Cullen turns around and Todd finds his face completely eclipsed by Cullen’s enormous ass. “I feel sorry for you rich boy. You’re about to experience how fat-assed I really am.” With that, Cullen sits down hard, slamming his huge ass onto Todd’s face. Cullen’s bubbly butt shields every inch of Todd’s head from being visible. I look on in shock but can’t deny that I’m starting to get turned on.
Cullen closes one eye and grunts.
PPPPPPFFFFFFFHHHHHHTTTTTT
My jaw drops as Cullen rips a 5 second fart right in Todd’s trapped face. Only then does Todd start struggling. He starts to muffly scream and thrash around. Cullen smiles as he easily keeps Todd’s face under his ass.
“Haha that’s it, struggle all you like, you ain’t goin nowhere. Imma break you like a bronco, rich boy.” With that, Cullen starts bouncing his titanic rump on Todd’s face and farting.
Bounce “Get a whiff of this shit”
BBBBBBBBMMMMMMMMPPPPPPTTTTTT
Bounce “Ah, this is the reason my friends call my big, talented booty the Cullen Canon”
RRRRRRRRAAAAAAAAFFFFFFFFPPPPPPP
Bounce “Get used to this Todd, my farts will be your only form of entertainment this weekend”
BBBBBBBBPPPPPPPPPHHHHHHHHHHFFFFFFFF
Bounce “Hey Todd, where’s your father’s checkbook to save you now buddy?”
PPPPPPPPPLLLLLLLLLLRRRRRRBBBBBBBBB
Bounce “With this next fart I christen you as my new fart-slave… GHH ”
FFFFFFFFFFFWWWWWWWW-UUUUUUUPPPPPPPP-HHHHHHRRRRRRRR
Cullen’s bouncing and farting is rapidly depleting Todd’s strength. Todd’s struggling becomes weaker and weaker by the second, especially after Cullen’s last butt bomb which was three consecutive farts in a row that lasts 20 seconds.
As Cullen remains seated on Todd’s face, he glances to the corner of the room and his eyes light up when he sees his backpack.
“Oh man, I forgot that I brought rope so me and the guys could use it to haze one of our teammates, but I think it’ll be more useful for my fart-slave.” After hearing this, Todd’s struggling begins anew.
This amuses Cullen, “Haha, it seems like I still have to break this bronco. Maybe an sbd will do the trick” With that Cullen leans to the left, lifting his right butt cheek off of Todd’s face. Half of Todd’s face is visible and his frantic eye finds me.
“Please Joe get this freak off of me, I-I’ll pay you anything. I-” Todd’s cut off as he starts dry-heaving, letting me know that he just got a nose-full of Cullen’s sbd. Cullen fully sits back down on Todd’s face, silencing him.
“That’s enough, out of you. A good fart-slave is a silent one.” Cullen says.
I start to walk up closer to them, Cullen narrows his eyes at me, ready to take me down if I try to help Todd. Instead, I walk past them, grab Cullen’s backpack, and I hand it over to him. Cullen smirks, “Thanks man”.
Cullen scrunches up his face and starts grunting and straining as he bears his thick ass down harder on Todd’s face. “Time for you to take a quick nap fart-slave. FGH… And don’t worry about the smell, you’ll never get used to it, hehe… NGH”
FFFFFFFFFFWWWWWWWWWBBBBBBBBBBBBBOOOOOOOOOOTTTTTTTTTTT
I go slack-jawed, amazed as Cullen rips a 35 second, behemoth of a fart right on Todd’s face. I surprise myself as I feel a little jealous of Todd. That is until Cullen rises off of his face and the vile stench of digested meat and sulfur escapes and spreads throughout the room. My eyes start to sting from the smell but I see that Todd isn’t moving.
“Is he still alive?” I ask nervously.
Cullen chuckles as he pulls several lengths of rope out of his backpack. “He’s still alive. I just knocked him out for a little bit.” Cullen says as he ties Todd’s ankles together and then ties his wrists together, behind his back.
“Cullen, what are we going to do? We’re going to have to eventually free him, and when we do he’s going to snitch on us.” I confess my worries.
Cullen looks at me questioningly. “He ain’t gonna talk or do anything I don’t want him to do. I already told you, I’m making him my fart-slave.” Cullen says.
I roll my eyes thinking Cullen is just bullshitting me. Oh how wrong I was back then.
Cullen catches on that I’m starting to freak-out. Cullen approaches me and suddenly shoves me onto the other bed. Next thing I know, he’s straddling my chest and looking down at me with a lopsided grin.
“You know, you’re not as subtle as you think. I’m constantly catching you staring at my butt when you think I’m not looking. And I see that you’re hard after watching me butt bomb the hell out of Todd’s face. You know what I think Joey? I think you want to get up close and personal with my Cullen Canon.”
I can’t believe I’ve been so obvious. Cullen’s grin grows at my look of alarm.
Cullen then turns around and says. “For helping me out with Todd, you’ve earned yourself a reward.”
I gasp as Cullen’s basketball-sized globes, trapped in a pair of ill-fitting shorts, hovers a few inches just above my face.
Cullen then says, “You know the only thing I like better than butt bombing a dick’s face, like Todd, is lighting up a cutie’s face, like yours, with my farts”
That’s all the warning I get before he drops his big ass onto my face. I feel his warm, doughy cheeks molding around my face, smothering me. And I feel his butt crack right on top of my nose. I then hear Cullen straining above me.
“NGH… You’ve just entered a warzone Joey. The Cullen Canon is armed and you’re in its blast zone… UGH”
BBBBBBBBBWWWWWWWFFFFFFFFRRRRRRRR
“Ah, that’s what my booty that you’ve been staring at for so long is capable of. Do you want some more? What am I saying, of course you do… HGH”
FFFFFFFLLLLLLLLLHHHHHHHHHPPPPPPP
RRRRRRRRRMMMMMMM-UUUUUUTTTTTTTT
“Whoa, you’re still hard as fuck. You must be loving the Cullen Canon. Well let’s see if I can make you regret that… GGH”
PPPPPPPPPPPPHHHHHHHHHRRRRRRBBBBBB
“You better be careful Joey. You won’t be my fart-slave but I’ll make you mine if you keep being this fun for me. You should think about that as I rip this monster… FNGH”
BBBBBBBBBRRRRRRRRRAAAAAAAAAMMMMMMMMMMPPPPPPPPFFFFFFFFF
Cullen rips a barrage of farts, pointblank in my face. His last one is a behemoth of a fart that lasts 45 seconds. My eyes are watering and I’m gagging against his bubbly ass. All I can smell is rancid fish and onions.
Cullen rises off of my face and glances down at me, laughing at my wrecked appearance. I gasp for semi-fresh air once I’m free.
“I’d love to drown you in more of my butt stink Joey but I’ve got a fart-slave to break in. And it looks like he’s waking up.” Cullen says as he hops off the bed and walks towards Todd, who’s indeed starting to awaken. Cullen stands on the bed, with his feet planted on either side of Todd’s shoulders, facing his feet, with his bulbous rump eclipsing all light above Todd’s face.
Todd’s eyes flutter open and he looks up in horror at Cullen standing over him with his fat bum lording above his face.
“Oh no, this-this can’t be real” Todd cries.
Cullen looks down at Todd, over his shoulder, and laughs, causing his ample cheeks to jiggle. “Haha, that was no dream Stinking Beauty. This trip’s just started and you and the Cullen Canon are going to become real acquainted before it’s over.” With that, Cullen drops his ass onto Todd’s face like a meteor. I wince some when I hear Todd’s pain-filled groan.
Cullen wiggles his meaty backside from left to right on Todd’s face, getting comfortable. Cullen then takes a deep breath and grunts.
BBBBBBBBBMMMMMMMUUUUUUUUUURRRRRRRRR
Cullen sighs in relief after ripping a 7 second, butt bomb on Todd’s face. “Ah, breathe in my precious butt stink fart-slave.” Cullen taunts. Todd’s bound-up body weakly twitches beneath Cullen.
Cullen then winces in pain as he starts rubbing his stomach. Cullen looks over at me and says, “I think you better make yourself scarce Joey. I’m about to rip some serious ass and it ain’t gonna be too pleasant.”
“Um, maybe I can stay a bit longer. You’ll probably be out of gas after this.”
Cullen smirks at my hesitance. “Go on Joey and you don’t have to worry about that. Haven’t you already realized it yet? The Cullen Canon’s never empty”
I reluctantly oblige his order and leave to go hangout with some friends. Just as I close the door and am safe, from the other side of the door I hear…
FFFFFFFFFRRRRRRRRRHHHHHHHHHHLLLLLLLLLLAAAAAAAAAPPPPPPPPPP
Cullen unleashes a monstrous fart that lasts a whole minute. That monster has so much power that I feel the doorknob rattling beneath my hand. I’m pretty sure everyone on this floor heard that.
I head towards the elevator, successfully willing down my hard-on. I meet up with my friends in the lobby and we head on out. I have fun with my friends but I can’t get the thought of Cullen torturing Todd with his farts, out of my head. So after an hour, I tell my friends I’ll see them later and head on back. On the way, I pick up two burritos from Chipotle for Cullen and Todd, since they probably haven’t eaten yet.
As I open the door to our room…
FFFFFFFFFFVVVVVVVVVVOOOOOOOOOPPPPPPPPPPP
I step into the room and find Cullen watching tv while still sitting on Todd’s face, smothering him underneath his plump ass. Cullen’s shirt is off now, revealing his chiseled abs and pecs. The room’s thick with Cullen’s eggy butt musk..
“Hey man, didn’t expect you back so soon.” Cullen says. Nonchalantly, he hikes his right leg up slightly and…
PPPPPPPPPPPWWWWWWWWWUUUUUUUURRRRRRRRR
“Oh um, I felt tired so I decided to come back here and relax. I-I’ll hang out with my friends after the trip.” I stutter out. Obviously unconvincingly going by Cullen’s smirk.
“Oh I’m sure that’s the only reason why you came back.” Cullen quips sarcastically before leaning to the side and closing one eye.
BBBBBBBFFFFFFFFFFFAAAAAAAATTTTTTTTT
Cullen rips a 6 second, bubbly fart right in Todd’s trapped face. Todd gives a muffled groan and slightly twitches but that’s it. Damn, this is the hottest thing I’ve ever experienced; I can’t stop myself from becoming hard. From Cullen’s growing smirk he notices it too.
I present my carryout bag to Cullen. “Oh I got you two Chipotle. I figured you guys were hungry.”
Cullen’s eyes light up. “Joey you’re a fuckin’ godsend. I’m fuckin starving” Cullen’s smirk then turns impish, “Chipotle huh? Did you know that this stuff makes my farts smell 100 times worse. Oh you two are asking for it tonight.” Once hearing that, Todd struggles harder beneath Cullen, making Cullen snicker.
“Well get on over here Joey and bring me my food. And while I eat we’ll chat and get to know each other. We’ve shared so many classes and hardly ever talked.” I hand the bag over to Cullen and take a seat on the edge of the other bed, facing him.
Cullen unwraps his burrito and starts eating and talking to me. Doesn’t even seem to matter to him that he’s still sitting on a guy’s face and lighting him up with farts.
“So where do you live” FART “No shit, I don’t live too far from there” FART “So any siblings” FART “Cool, I’m an only child” FART “Hmm? Oh yeah I’m always a gassy fuck” FART “You’re talking to the Fart King baby” FART “When it comes to farts no one has out-gassed me yet and no one ever will” FART “So what are your plans after highschool? College?” FART “No shit? I’m attending the same school” FART “Hey maybe we can be roommates” FART
Before I can reply, Cullen holds up a finger, stopping me. “Just a second Joey, my fart-slave’s trying to tell me something” Cullen lifts his titanic rump up, revealing a panting Todd.
“I-I just wanted to apologize for how I treated you two and surprisingly I’m going to the same college as you guys. Maybe we can start over and be friends.” Todd raggedly explains.
Cullen unceremoniously drops his fat cakes back onto Todd’s face, smothering him. “Nope. Once a fart-slave always a fart-slave. I’ll never see you as a person again and soon enough, neither will you… GGH”
PPPPPPLLLLLLFFFFFFFTTTTTT
Cullen leans forward, revealing Todd’s face again, who’s in a coughing fit. Then Cullen pulls down the back of his shorts, exposing his hairy butt crack; making me nearly bust.
With Cullen’s fat, bare ass only a foot from his face, Todd looks freaked out. Cullen unwraps the second burrito and rips a piece off. He then brings that piece, behind his back, and in front of his bum. Cullen grunts and…
BBBBBBBFFFFFFFAAAAAAPPPPPP
Cullen rips a 5 second fart, coating the piece of food in his butt stink. Cullen sighs in relief before bringing the tainted food to Todd’s lips.
Cullen looks down at Todd, over his shoulder, with a cruel smirk. “Open up fart-slave, it’s supper time.”
Todd keeps his lips sealed and turns his head, but Cullen still wears that nasty smirk. “Now, now fart-slave, we can do this the easy way or the hard way. Either you can eat your food like a good fart-slave, or I can pry open your mouth and force the food down your throat with my farts. Personally I’d choose option A. You’ll have to swallow fewer of my burrito-powered butt bombs with that option.”
With tears in his eyes, Todd reluctantly opens his mouth. Cullen pops the fetid piece of burrito into Todd’s mouth. Todd retches and gags as he chews, but he eventually swallows Cullen’s butt-poisoned food.
“There’s a good fart-slave. Now say ah, there’s plenty more where that came from.”
FFFFFFFFWWWWWWWWWWWHHHHHHHPPPPPPP
BBBBBBRRRRRRRRRRAAAAAAAAAAAFFFFFFFFFF
PPPPPPPPPHHHHHHHHHHUUUUUUUUUBBBBBBBBB
RRRRRRRRRRLLLLLLLLLLLLMMMMMMMMPPPPPPPP
BBBBBBBBBBBTTTTTTTTTTTFFFFFFFFFFFRRRRRRRR
FFFFFFFFFFFFMMMMMMMMWWWWWWWWTTTTTTTTTT
PPPPPPPPPPPPPFFFFFFFFFFFFFFOOOOOOOOOBBBBBBBB
FFFFFFFFFFFFFBBBBBBBBBBBBAAAAAAAARRRRRRRRR
RRRRRRRRRRRRUUUUUUUUUUWWWWWWWWPPPPPPPPP
BBBBBBBBBBBHHHHHHHHHHH-PPPPPPPPPPPPRRRRRRRRR
Nearly a dozen farted-on pieces of burrito later, Todd’s finished with his meal. He looks like he is in complete agony. Unfortunately, Cullen isn’t done.
Cullen reaches back with both hands and spreads his ample cheeks, exposing his fume-sputtering pucker to a horrified Todd.
Cullen carelessly falls back, lodging Todd’s face in between his meaty globes. Cullen narrows his eyes in concentration as he starts grunting and straining. “Just in case you’re still hungry fart-slave I’m about to feed you my personally made beefstew. Piping-hot, straight out the oven. NGH… bon appetit… UGH”
FFFFFFFFFFFFRRRRRRRRRRRWWWWWWWWWWOOOOOOOOOPPPPPPPPPP
Cullen decimates Todd’s face with a 2 minute long, monster of a fart. Cullen fart is so monstrous that it has his whole bed shaking through the entirety of it. It also seems to take out Todd. Todd’s struggling becomes weaker and weaker after every second of Cullen’s fart until he seems lifeless half-way-through.
Cullen’s eyes are closed and he sighs in relief as his mammoth of a fart comes to an end. “Ahh, damn that felt good.”
Cullen lifts up, freeing Todd’s face, accompanied by a wet schlorp. Todd’s face is drenched with Cullen’s ass sweat, and a few of Cullen’s wiry butt hairs litter his face.
Cullen isn’t finished. With his ass still hanging out, Cullen gets off his bed, tackles me into mine, and straddles me. A moment later I find myself on my back, with Cullen’s bare, fleshy ass mounds hovering inches above my face.
“I seem to remember you doubting the Cullen Canon’s power earlier today Joey, and I aim to show you otherwise. The Cullen Canon just k.o.ed my fart-slave and now it’s your turn. In you go”
With that Cullen plants his big, fuzzy ass right on my face. Like Todd, I feel my face sinking in between Cullen’s fat globes. His doughy cheeks pour over the sides of my face, devouring my head entirely. Even with my head completely entombed in Cullen’s plump ass, it’s apparently not deep enough. Cullen starts working his hips above me, making my face sink deeper in between his bountiful globes. He finally stops when I feel my nose and upper lip press against his butthole.
“Hey Joey, do you still doubt that I have enough farts to handle the both of you… HGH”
BBBBBBBBBBBFFFFFFFFFFFFFWWWWWWWWWPPPPPPPPP
PPPPPPPPPPPPLLLLLLLLLLLLHHHHHHHHHHHHFFFFFFFFFFF
“Ah, thanks for the burrito man, here, you can have a taste of my beef stew too… GGH”
RRRRRRRRRRRUUUUUUUUUUU-PPPPPPPPPPPBBBBBBBBB
“Oh yeah, I’m brewing up something bad. Are you still glad you got me a burrito… NGH”
PPPPPPPPPPWWWWWWWW-TSTSTSTSTSTSTSSS
Cullen keeps ripping one raunchy fart after another right up my nose. The atrocious stench of digested meat and methane is all I can breathe, and it has my lungs feeling like they’re on fire. Even with all that, I’ve never been so hard in my life. I can’t stop myself. I stick out my tongue and start lapping at Cullen’s sweaty, toxic-spewing, winking pucker.
Cullen starts moaning above me.
“Oh fuck, no one’s ever licked my hole willingly. Oh you’re definitely a keeper. I ain’t gonna stop farting until you reek of my booty. After that everyone will know that you’re mine… NGH”
RRRRRRRRRRRRHHHHHHHHHHHLLLLLLLLLLPPPPPPPP
FFFFFFFFFFFFFWWWWWWWWW-OOOOOOOORRRRRRR
PPPPPPPPPPPPPLLLLLLLLLUUUUUUUUUUUFFFFFFFFFF
“Mmm, it seems like you’re gonna pass out. Your nose and the Cullen Cannon will become the best of friends after today, so don’t worry. We’ll have a lot of smelly fun after tonight. Nighty-night… UGH”
BBBBBBBBBBBRRRRRRRRLLLLLLLLLLAAAAAAAAAAPPPPPPPPTTTTTTTTTT
Cullen drops a series of massive butt bombs, pointblank in my face, obliterating my sense of smell. The putrid stench of raw sewage and spices is all I can breathe in. Cullen’s final fart is a true beast that lasts over 2 and a half minutes long. At the 2 minute mark I unfortunately pass-out.
SEVERAL HOURS LATER
BBBBBBBBFFFFFFFFF-OOOOOOOOOUUUUUUUU-WWWWWWWPPPPPPPP
I’m startled awake by a series of loud eruptions going off in my face. Next, the stench of rotten eggs and garlic assaults my nose. My eyes shoot open, and a wall of gray dominates my field of view. Momentarily, I don’t know what I’m looking at.
FFFFFFFFFFFFFFFWWWWWWWWWWWUUUUUUUUUUUTTTTTTTTTTT
Everything comes back to me as another explosion erupts in my face. I’m lying on my back, in the hotel bed, with Cullen squatting over my face. His shorts-clad, fat bum is right in my face, dropping butt bombs. Cullen’s noxious ass gas flows up my nose and has me coughing and gagging.
Cullen sighs in relief before hopping off my bed. I look at Cullen with watery eyes and he smirks back at me. “That’s my way of apologizing for last night, Joey. I might have gone a tad overboard. You licking my asshole just triggered the possessive part of me. And I wasn’t lying, I do wanna make you mine. But don’t worry, not like Todd. I don’t want you as a fart-slave, I want you in a more intimate way.” Cullen’s confession has my cheeks reddening.
“Oh and I’m also sorry about not farting on you anymore all last night. I spent the rest of the night butt bombing Todd, breaking him into being my fart-slave. And it finally worked, at 3 a.m. this morning, I did it, I finally broke him.” Cullen explains.
I glance around the room and see no sign of Todd. “Uh, Cullen, where’s Todd?”
“Please just call him fart-slave when it’s just us Joey, he isn’t a real person anymore. And I made him go get us breakfast, he’ll be back in a bit.” Cullen says nonchalantly. He then looks at me with a cocky grin. “He’s also working on a special gift for you and me.”
I’m starting to feel pretty anxious. “Are you sure he’s just getting breakfast and not getting help Cullen?”
Cullen rolls his eyes, “No joey, he’ll follow whatever I say to the letter, trust me. He isn’t the first fart-slave I’ve broken in.”
“I know I-” I pause as Cullen’s last statement dawns on me. I almost can’t wrap my head around this. The day before yesterday, I used to see Cullen as the sweetest guy known to man. He was always nice to everyone and was always smiling. Maybe that was just a facade, and this version, this evil version of Cullen is the real one. A man who enslaves others with his farts.
“You have other fart-slaves?” I ask breathlessly.
Cullen gives me a devilish grin as he starts to approach me with slow, small steps; he rips a sizable poot with every step.
“Yes I do” POOT “My first fart-slave I made was my ex” POOT “When I found out that he was cheating on me I decided to tie him up and torture him the entire day with my farts” POOT “Once I was finished with him, I accidentally wound up creating my first ever fart-slave” POOT “My ex was a pretty smart guy so I make him do all my homework” POOT “And he’ll be doing all my college homework as well” POOT “Next, I decided to make it a complete set” POOT “I found the guy my ex cheated on me with and turned him into my second fart-slave” POOT “He’s got a car so I make him drive me wherever I want” POOT “He’s my own personal chauffeur” POOT “I make sure to fart in both of their faces multiple times a day, forcing them to smell my nasty butt vapors” POOT “Making sure that they’re frightened of the Cullen Canon, is how I keep them under my thumb” POOT “And now Todd’s about to be my third fart-slave” POOT “His rich folks are gonna pay for whatever I want” POOT
When Cullen reaches the bed, he climbs in and straddles my chest. I wheeze as he sits his meaty ass onto my chest, forcing the air out of my lungs. Cullen’s gazing down at me with a seductive smirk.
“Oh Joey, if I were your boyfriend you would want for nothing. With my noxious butt bombs I’d ensure that anything you desired would fall right into your lap. And all you’d have to do is show me and the Cullen Canon some love. However, there’s a big risk. If you’re ever unfaithful or try stabbing me in the back then it’s over for you. You’ll join the others and become my fourth fart-slave. Knowing all that, what’s your decision Joey?”
I already know I’d never betray this farting god and in a way I already feel enslaved by his gassy prowess. I’m already nodding my head. ‘Yes Cullen, I’d love to be with you. To be yours.” I declare.
Cullen grins genuinely. “Excellent, let’s make this official with a kiss on the lips”
With that Cullen spins around and pulls down the back of his shorts. I once again find his bare, fat, hairy ass hovering inches above my face. Cullen then reaches back and spreads his fuzzy cheeks before planting his cavernous ass onto my face again.
My face, once again, is swallowed up by Cullen’s voluptuous backside as he sits on it. But this time, I feel his winking pucker pressed right up against my lips. From above, I hear, “Prepare yourself Joey, the Cullen Canon is about to lavish you with its raunchy love. And we also need to build up your endurance. From now on this big fella’s gonna be laying smelly smooches on your lips several times a day. NGH… Lucky you… UGH”
FFFFFFFFFFFHHHHHHHHHHHBBBBBBBBBBBBVVVVVVVVVVVVVPPPPPPPPPP
A minute and a half of fetid ass wind explodes out of Cullen’s hole and vents into my open mouth. My cheeks inflate like birthday balloons the entire time. I can both taste and smell Cullen’s hellish butt fumes as it flows down my gullet and it’s overwhelming. As Cullen’s monstrous fart nears its end, I mercifully blackout.
I slowly awaken to the sound of a conversation. I lift my head and see Cullen talking to Todd, who has two plates of breakfast in his hands.
“So did you do it fart-slave?”
Todd nods his head, “Yes master, my dad will be buying me a three bedroom house near campus and I’ll be sure to put it in your name.”
Cullen smirks, “Excellent work fart-slave you’ve earned yourself a reward. Tonight you’ll be sleeping under the covers while I Dutch oven you, but I’ll not be doing it bare-ass.”
Cullen looks over at me and smiles when he sees I’m awake. “Hey did you hear my present for us Joey? We’ll be living in a spacious, three bedroom house when we start college. One room will be our bedroom, the second can be our home gym, and the final room can be a place where I hold my fart-slaves when I’m not using them.”
I smile back, “Damn, you and the Cullen Canon are already spoiling me.” I say lovingly.
Cullen smirks and gives me a wink. “I’m not done yet, I also ordered some breakfast.”
Cullen takes the plates of breakfast and hands one to me. He then looks down at his own and frowns.
“What the hell is this?” Cullen angrily demands Todd, as he points at the glass of orange juice.
“It-it’s orange juice master”
“I fuckin’ hate orange juice! I told you that before you left!”
Todd’s shaking with fear. “I’m sorry master, I-I forgot”
“You didn’t forget, you just weren’t fuckin’ listening. Maybe something’s in your ear. No worries fart-slave I got a remedy for that.” Cullen grabs Todd by the shoulders and roughly shoves him to his knees. He then spins around, putting his bulbous rump in Todd’s face. Cullen then reaches back, twists Todd’s head to the side, and pulls the side of Todd’s face into his doughy ass mounds. Cullen lifts his left leg up slightly and grunts.
PPPPPPPPFFFFFFFFTTTTTTTTBBBBBBBB
Cullen rips a 4 second trumpeting fart right into Todd’s ear making him scream.
“Oh you ain’t goin’ anywhere. Congratulations, you’ve earned yourself a gassy hour with the Cullen Canon, fart-slave.”
Cullen grabs Todd by the collar of his shirt and drags him to the corner of the room. Cullen sits Todd down in the corner, spins around, bends at the knees, and thrusts his bubble butt into Todd’s face, muffling his crying and pleading.
Cullen braces his hands on the adjacent walls and starts straining.
“NGH… Seems my fart-slave is in need of more training. This’ll teach you to obey your master… FGH”
BBBBBBBBLLLLLLLLLLLLLLL-WWWWWWWWWTTTTTTTTTT
I watch on in lust as Cullen tortures Todd with his butt fumes. I disregard my breakfast as I whip out my hard-on and start stroking myself. I’ve always seen Cullen as the nicest and sweetest person in the world; only to find out that behind closed doors, he’s a sadist who loves to enslave people with his noxious farts. And I think that makes him all the hotter.
Cullen notices what I’m doing and smirks naughtily. Cullen brags as he keeps ripping ass in Todd’s face.
“Yeah, keep stroking that cock babe” PPBBT “If you’re into farts then you’ve found the perfect man” RRRFP “I’m a fuckin’ farting god” FFWWB “Before noon I’ll have you shooting blanks” PFFFR “Because when I’m done with him, you’re next” BWPPP “I’m gonna be destroying the both of your noses all day with my nasty ass gas” FFPPB “Here take a listen to this, this is a preview of what you’re in for… UGH”
Cullen proceeds to rip a booming, room-quaking fart in Todd’s face that makes me shoot my load.
BBBBBBBBBBBBBHHHHHHHHHHHVVVVVVVVVVVVVMMMMMMMMMFFFFFFFFF
The Role of the Hole
It was official. Some men became so vile and raunchy in body odor, that submissive sniffers became the new norm in society. These sniffers were a mix of horny volunteers, and unlucky citizens that fell into a life-long duty of inhaling whatever rank scents a man could produce. Tyler thought he had everything in life. He made good grades in school, he was first in his class and about to go into his final year of med school. As they studied the qualities of the “Vile Male”, Tyler breathed a sigh of relief that he one… didn’t contract the disease, and two didn’t wind up as a sniffer for one of these vile stinky guys. “As you can see class… this man’s sniffer looks to be a volunteer. See how erect he is?” The class oohed and ahhed at the man’s package. The man getting sniffed was sporting some wood as well.
“Class… what you have here… is not a volunteer. This is a new phenomenon recently discovered. This sniffer has been subjected to the smells of this guy’s B.O. for years. Eventually, the attraction to his stink was taught.” The professor called on a student with a question. “So what you are saying, sir… is that this guy inhaled so many farts that his brain and sexual desires were completely rewired!?” “That’s correct, Brian.” Tyler rolled his eyes after his adversary’s inquiry. The two had butted heads all through college. Brian was determined to become a better doctor than Tyler. “OH GOD! The sniffer is flat lining!” It was always bound to happen eventually. Sniffers were intended to inhale as much odor as possible from this new breed of man in order to keep the air fresh for the remaining population. Eventually, their lungs would give out. “Volunteers!!! Volunteers? Any Volunteers?!” A nurse cried out to a room full of promising doctors. There was no chance that any of us would volunteer. That was until Brian grabbed Tyler by the shoulders and pushed him down the auditorium steps.
“GREAT!” The nurse ran out to Tyler and grabbed him hastily. It would be a huge tragedy if that man’s odor got out and spread throughout the college. The entire campus would be nuked with stink. Tyler was in tears. He didn’t volunteer! His face was strapped to the same gas mask as the dead guy once used. The smell was awful. Worse than that? His smelly master gripped the top of his head, and pushed out a vile, wet, sputtering fart that traveled up the mask. BBBRRRRRCCHHHHPPPPPPPFFFFFTTT! “MMMMMMPPPPHHH!!!” Tyler screamed and gagged as the smelly guy laughed. “Looks like we got you a new sniffer just in time man!” The professor laughed. “Oh yeah… well… I was told my sniffer had pretty weak lungs, and to go easy on him for a bit… looks like he just couldn’t take it anymore… I sure do have a ton of gas left thought… so y’all are lucky I was able to hold it all in until I got this new fella!” He rubbed his tummy and blasted another fart that went straight into Tyler’s nostrils.
“Fuck! Tyler’s already hard!” Brian and the class laughed at their former classmate. Tyler was embarrassed… he had suppressed these feelings and STILL he wound up as ‘one of them’. “I think I’m gonna like you man… we’re gonna have fun tonight… I’m having chili!” The vile man winked. Tyler was carried away in restraints and was forced to follow his new master on his knees. “Smell that cheesy crotch man? I never shower… and honestly when I do it don’t do me any fucking good.” Tyler cried as his cum dripped into his shorts. His new life as a sniffer was going to be hell.
Let this serve as a lesson, homo. Always respect your superiors. Now I wanna hear big sniffs, go on…
You were on vacation with two of the biggest douchebags in your fraternity, Chase and Blake made sure to fuel up on the way up. You were the driver and had to stop at every fast food place for these guys. They stunk your car up so bad and you weren’t able to unlock the windows or else you’d be underneath there ass all vacation. When you all got there they went out to the deck. They called you over and unleashed a giant barrage of smelly farts right in your direction. “Hahaha smell that fag”. They grabbed you and dragged you into the bedroom. The night was a complete blur, all you remember was waking up under both of their bare asses. BBBBLLLLRRRRPPPP “sniff that rip and go back to sleep bitch, we aren’t done with you”.
Nostalgia Trip (Commission)
(Contains: M/M, Farting, face/mouth-farting, kidnapping, bullying, age-gap, non-consent, foot licking, poor hygiene, mild scat, references to underage.)
[DARREN]
Darren couldn’t believe his eyes. He’d travelled down to his alma mater to help him son get settled in for his first semester, and who should his boy be rooming with, but his good ol’ fart sniffer Luke? Only, it wasn’t Lukie Boy, it was some guy named Jordan, who’s his absolute spitting image. He had to brace himself on the cheap dorm desk. He felt like he’d fallen through some sort of time rift. The boy’s hair was a bit longer, and his face a bit sharper due to the added couple of years, but other than that, the young man in front of him could have been Luke’s doppleganger. Same straight brown hair, pale skin, full lips, blue eyes. Same skinny but tall build. The sort of Nancy boy who deserved to be put in his place—used by real men.
Keep reading
NOT MY STORY JUST SOMETHING I LOVE THE IDEA OF:
John was sitting at his armchair in his living room, thinking for a long while. Would it work well? He thought it would. He looked up at the clock and saw the time. It was a quarter to 3. If the guy who emailed him was serious about this, he would be getting off the train at 3:15. John got up, grabbed his coat, and left his house.
The train pulled into the station. People got out. John sat in his car, waiting for the guy who had reached out to him. He stepped off the train, just as he said he would. He was short, a scrawny nerdy looking guy with blond hair and glasses, not too shabby an outfit. Sweater over a shirt and khakis. He was probably a tech guy. He was scanning the parking lot for John’s car, and when he saw it, he paused. Maybe he was second guessing? Whatever nerves had caused him to pause, he dropped them and walked toward John’s car, a slight tremble in his steps. In that moment, John felt the urge to fart. He held it in. John’s cock was hard in his pants.
“Ben?” He rolled down the window.
“Yeah, John?” He gulped.
“Come in.”
He got into the car and buckled his seatbelt, “Thanks for picking me up,”
“Yeah of course. Besides, no offense, but I don’t give my address out to people who might flake.” He turned out of the parking lot, “You still want to do this?”
“Yeah,” Ben was smiling wide. He thought John looked even hotter in person; rugged black hair and scruff, a strong physique...he had seen naked pictures and knew he was hairy under those clothes.
“Good. Do you want lunch or anything?” John gave out a little laugh, “Will probably be your last good meal for a while,”
“No it’s ok, I ate before I got on the train,” Ben was shaking now. John grimaced. He didn’t want to bring this stranger to his house if he started having doubts and backing out. But there was not much he could do. In the email, he was clear that Ben was allowed to say no at any point before they start. After they started, Ben would have no choice. That part turned Ben on, he’d said.
They reached his house. It was an ordinary single story house. It didn’t stand out from the others in the neighborhood. It had a chimney, but John didn’t use the fireplace for years.
“You know, I’m still surprised that you found my ad,” John said as they got out of the car. “I thought that site would have taken it down by now.”
“Nope, it’s, uh, still up.” Ben had gone quiet in the car. John could tell he was nervous. Once they got into the house, Ben asked “Ok so, where is it?”
John smiled again. Maybe the nerves were because of excitement. “Follow me.”
He brought him into the living room. It was relatively small. His armchair was against one wall. The couch was against the other. Three large windows looked into the back yard. Across from the armchair was the TV. John gestured toward the armchair, “Here it is, just like I told you.”
Ben was trembling a lot now, and he looked at the chair, his eyes glued to the seat. “It really works the way you said, in the email?” His voice was faint.
“Yep. I’ll go over just to be clear,” With a grunt, he pulled the chair away from the wall. Ben couldn’t believe what he was looking at. It was exactly as it was in the pictures. The same pictures he had been jerking off to for the past week.
It was a large square hole in the wall. John had explained that it was where the fireplace used to be, but he didn’t want to pay extra for gas so he had it removed. Instead of patching up the wall, he left the hole. He’d also done a lot of DIY. He expanded the back of the wall, which took some space out of his bedroom closet but he didn’t mind that. He built a small drain that went down into the house’s sewage pipes. Just above that was a long board with wheels, what resembles a hospital gurnee. There were straps around it. There was also a hole in the middle of the board.
“Alright,” John sighed, his arms on his waist, “So...to recap. You’ll lay down here. I’ll strap your arms, ankles, legs, and chest in so you can’t move. You’ll be naked and your ass will go in that hole. I’ll put a funnel system around your dick and under your ass. That way, you don’t have to come out for the restroom or anything, you can just go into that hole. Kind of gross but it takes care of that problem at least.”
Ben gulped, “Ok,”
“You’ll be completely strapped and so, won’t move around. Then, I”ll put the chair over you. As I showed you,” He gestured toward the back of the chair, the bottom of it was hollowed out, “I fixed this old armchair up so that the cushion has a rim-chair built into it. When I put the chair back in place, I will turn the knobs on the gurnee and it will lift you up so that your face is at the seat level. See?” He unveiled the top of the seat, which looked like a normal cushion at first but turned out to be a thin fabric hiding the rim-chair. “Your face will be in that hole. And...uh, yeah that’s it. I’ll sit on your face as long as I want.”
Ben’s heart was pounding. John continued, “This fabric is in case I have friends over. Which I will, tomorrow night. I invited some buddies to come watch the game. Don’t worry, none of them will be sitting in this seat. Your face belongs to my ass only,” He smiled wide, “Just as I said in my emails, when you are my chair, you have no rights. You cannot say you want out at any time. If I need to fart, I’m farting up your nose. If I want my hole licked, I’ll sit on you naked and that will be your only cue. The only time you matter is when I ask if you are hungry or thirsty, and I’ll give you food and water. Otherwise, you don’t give me instructions. I’m not interested in conversation, because I don’t talk to chairs. If you are uncomfortable and want me to loosen the straps, too bad. If you’re sick of my farts, too bad. As we agreed, you belong to me for the next 48 hours. There are no safe words. If you want out now, I’ll take you back home. But the minute I put you in the wall is the minute you belong to me. If at any point in the next 48 hours you want to stop, and go home...too bad. My ass is your home until the weekend’s over. Do you understand?”
Ben’s face was white. He’d been jerking off to this kind of fantasy for so long, and when he found John’s ad online, he couldn’t contain his excitement. But now that he was in the house, he was terrified. It was too real for him. What if he hated it? What if in the very first minute he hates it after all? He’d never done something like this before. He’d never actually been smothered under a man’s ass, he’d never sniffed farts, never done anything kinky like this. If it turns out he doesn’t like it...he’ll be stuck as a human chair for two days.
“Do you understand?” John was deliberate.
“Yes sir,” Ben gulped, “I...I’m sorry this is just so hardcore...I’ve heard of people doing these things but I haven’t really done BDSM stuff with anyone,”
“Do you want to call it quits?” John asked again. “I won’t be mad.” That wasn’t entirely true. He would be annoyed and disappointed if the only person who responded to his ad decided to say no at the literal last minute. He’d been dying to try out his new toy for months. But he was still a good guy. He wouldn’t pressure anyone into doing it. In the emails, Ben seemed very excited. Maybe he was more in love with the idea of being a human chair than actually doing it. John would cut him slack since he has never dipped into bondage play before.
And Ben was nervous. He stared at the hole for a long time. The silence was more awkward with each passing second. Finally he took a deep breath, “No, I...I’m ready.”
“Ok. Take off your clothes.”
Ben stripped. As he undressed, his face was flushed. John seemed like a nice guy over their email conversation. But how could he put so much trust in a stranger on the internet? The only solace that Ben had was knowing that in these last few moments before they started, he was in complete control. At any second he could say “Nope” and go back home. But that window of time was getting smaller and smaller. John had pulled the gurnee out from the hole in the wall. There were seven straps. Two for each ankle, two for each wrist, one for his thighs, one for his chest, and one for the neck. There was a little padded indent at the front where his head would rest, two little rounded poles came up on either side. He didn’t know what they were for.
“Alright, if you are ready, lay down on your back.”
Ben stood in the living room naked. His cock had gone hard and was throbbing. He knew that once he was strapped in, he wouldn’t be able to touch himself at all for the whole weekend. That was part of the fun.
“And I’ll take your glasses for you,” He said. Ben took them off and handed them over. John asked, “can you see at all without these?”
“A little,” he shrugged, blinking, “I can’t see far away.”
“Ok. Not that it matters, you won’t be looking at anything but my asshole.” He picked up Ben’s clothes and put them on the table.
Ben sat down on the gurnee and got into position. Laying down, his ass was over the hole. When he had to go, he would just relieve himself into the tube that John would set up. That was the worst part, to him in the moment, thinking how disgusting and unhygienic it was. But he wouldn't have another choice. John had suggested wearing an adult diaper, but that sounded even worse.
Ben tightened the straps around his ankles. Then he tightened the strap over his thighs. Then, around his wrists. Ben’s heart was beating too fast. He tried to control his breathing. John tightened the strap over his chest. Almost as a reflex, Ben jerked his body a bit but he couldn’t move at all. Delicately, John guided Ben’s head down on the padding, and carefully wrapped the strap around his neck and tightened it just enough to keep him from moving his head up. Ben gulped, he felt the strap. He could still breathe fine at least. John moved over to fit a large tube over Ben’s dick, and pointed the other end of it down the hole in the gurnee between Ben’s legs. He set up a similar tube under Ben’s ass. Then, John turned some knob near Ben’s head, and the two poles on either side came together and pressed into his temples just above his ears. They weren’t tight, but they were set in place so Ben couldn’t turn his face to the side. He was completely immobile.
“Alright. This is your last chance,” John stood over him, his crotch was at the level of Ben’s face. From here, Ben saw John at a glorious angle. He looked so tall, buff, powerful, a dominant man. “Are you absolutely sure you want to go through with this?”
Ben nodded as much as the poles and straps allowed him to, “Yes sir. I...I need to be your chair. It’s my destiny” Ben’s cock was throbbing against his belly.
John smiled widely. His crotch was bulging. He had been horny since they started talking online. “You have no idea how much I’m going to love this. This has been my fantasy for years but I couldn’t find guys who were into it. You’ll be my first chair. You should be honored.”
Ben gulped, his face was burning red, “I...I’m very honored sir. I hope I serve you well.”
“You only have three jobs once you’re in there,” John said, “First, sniff all of my farts. I don’t want to smell a single one. Second, eat out my asshole whenever I’m naked. Third, don’t talk unless you are asking for food and water.”
“...ok,” Ben’s voice had gone weak. He was starting to feel dread now. Excited and horny, but also dreading if he’d made the wrong choice. But it was too late to say anything. He had to go through with it. As he said, this weekend is his destiny now.
It was settled. John slowly pushed the gurnee into the old fireplace, lining it up right. He had sealed off the chimney long ago, so it wouldn’t be cold in there. Ben’s body was completely hidden in the wall. Only his head and shoulders were sticking out, held down on the gurnee. Using his feet, John kicked down the wheel stops so that the gurnee couldn’t move if Ben shook around. John then pushed the chair back in place against the wall. Then, he got on his knees and stuck his hand under the chair. He found another knob and twisted it a few times to lift the gurnee up. As promised, Ben’s nose peaked through the hole in the seat. John stood up, and saw through the built-in rim seat, Ben’s face was the only part of him exposed. John grabbed the fabric from earlier and reminded him, “This is only to cover you for when my friends are here tomorrow. Don’t worry, they won’t see you. But it is thin enough that my ass will mold over your face and you will still get to smell everything.”
“Um, John,” Ben was shivering, “can we...or, ok, wait, pause, can we just do this for maybe half an hour at first, just to test it so I can see what it’s like before we do the full two days,”
John burst out laughing. It sounded evil in the moment. Ben’s face went white this time, the same dread creeped back. John said “I just told you minutes ago that don’t have conversations with chairs. No normal person speaks to a chair. But since you’re new to this I’ll let it slide. Your time for negotiation is over. If you wanted to only do half an hour, you should have said so in the email. But nooo...you’re pathetic little dick was throbbing when I said 48 hours. Remember you told me that? Throbbing. You loved the time we picked. So I’m sticking with it. It is,” he looked at the clock, “4pm Friday. Meaning that you will be here until 4pm Sunday afternoon. And now I’m done talking to you.” He sighed. Ben was whimpering. He was afraid he’d made a terrible mistake.
“I have been holding this fart in since I picked you up from the train,” John smiled again, “And you’re going to vacuum suck it out of my jeans.” he turned around. His ass looked huge from this angle, and he slowly lowered it over Ben’s face. The cushion supported his butt cheeks, and lightly spread them in his pants. They molded over Ben’s face. John shifted around until he felt the tip of Ben’s nose wedge up against his asshole. Now John was shaking. His cock was hard. He gripped the armrests of the chair and pushed.
PPPPPPRRRRRRRRRRRRR
The fart came out much louder than he thought it would be. It vibrated deep into the chair. He burst out laughing. He felt Ben cry out into his ass, and he heard the gurnee wheels squeak. He was buckling around down there, making the gurnee shake a bit, but John knew it wouldn’t move. And he knew that there was nothing Ben could do to get his face out from his ass. The straps and post made it so he had no choice but to keep his head up, and if John wanted to fart directly into his nostrils, he could. And definitely would.
“Again, I’ll be nice since you’re new to this,” John cleared his throat, “You can’t be making any noise down there. The next 24 hours will be great practice for you to suck in my farts without freaking out and screaming.”
He felt Ben settle down, and felt him sniff and cough into his ass cheeks. John said, “Ok and also you really need to not cough or gag or anything. Anyway, now we can start for real.”
And with that, John stopped talking. Because why would he talk to a chair? He flipped on the TV and watched an old sitcom rerun. He felt a silent but deadly fart seep out and warm his butt. He shivered in delight, feeling extra comfortable in his new chair. If anyone else lived in the house with him, walking by they would just see John sitting in his favorite chair watching TV, and not think twice.
…
The next couple hours were uneventful. The sun set and it got dark in the house quick. John had some lights on and was still watching the show. At one point he got up to grab a bag of chips. As he stood up, he heard his chair coughing and sucking in fresh air. John laughed. In the kitchen he poured some chips into a bowl. Then he walked right back to the living room and sat down. Obedient so far. He didn’t have that much gas. Just a few short, quiet farts whispered out of his ass. They must have stunk pretty badly because each time, he felt muffled coughing against his butt cheeks, and heard the gurnee shake a bit. John had a huge smile on his face, and he was hard the whole time.
At around 7pm he turned off the TV, got up, and went to the kitchen to make some dinner. Nothing special. Leftover beef tacos. Even though it wasn’t healthy for him, he heated it up with a heaping handful of pre-shredded cheese. His grin was so wide. He’d mentioned in earlier emails that he was lactose intolerant, and that he would purposefully eat dairy so that he had more frequent and more foul smelling gas. In Ben’s reply, he said “my cock is drooling at the thought”. So, why not stick to his word? He’ll feel gross for the rest of the night, but at least John wouldn’t have to smell any of his own farts. He quietly ate his tacos in the kitchen, texting his friends about what beer he should get for the party tomorrow.
Closer to 8pm, he came back to the living room. He wanted so badly to look down at his chair again, but part of the fun was not acknowledging Ben as a person. He had to treat the chair like he would treat any other chair; with apathy, and disinterest. He sat back down, shifting a bit and feeling his cheeks separate so that Ben’s face wedged into his ass again. He puckered his hole to make sure that it was right over his nose.
“Ugh, I shouldn’t have put cheese in those tacos” he pretended he was talking to himself, “My ass is gonna be ripping up a storm tonight.”
He sat back and turned the TV on again. This time he watched the next episode of his favorite cop drama.
His guts gurgled. His dick got hard. He knew that his chair had heard the gurgling too. John could feel his face scrunch up, embracing for impact. He grunted,
PRPRRRRRT
A wet sounding fart sputtered out of his ass. John sighed. He felt the chair sniff, and then it made a violent gagging noise. Again, he felt the chair shake a little as Ben’s body jerked as a reflex. John held back laughter. His own lactose farts made him feel queasy. He couldn’t imagine how unbearable they had to be injected right up the nose. He looked at the clock. Only 45 more hours to go.
At 9pm he got up, and to his surprise, the chair spoke,
“John can we do a time out,”
“Huh?” He looked around, pretending that he was alone, “That’s funny, I could have sworn I heard someone speak even though there’s no other human in the house,”
“John I’m serious,” the chair pleaded, “Your farts stink really fucking bad, I need a break,”
John grit his teeth, and said, “Ok, quicktime out. Yeah, of course they stink. They’re farts. Not rose perfume. Second, you don’t get breaks, remember? You are my chair.”
“Yeah,” Ben’s voice was faint, defeated. They’d already talked about this at length over email, but it wasn’t until that moment that Ben had internalized the reality of it.
“Now, I’ve been way too nice to you so far,” John continued, “So if you speak without permission again, I’m not going to be nice. Ok?”
The chair didn’t say anything.
“Good chair.” John nodded. “You hungry?”
“Yes sir.”
John went into the kitchen to make food. Ben stared up at the ceiling, his whole body trembling. This was really happening. He couldn’t stand John’s noxious farts. Each one made him feel sick to his stomach. But he had no choice. Just as he promised, he was completely at the mercy of John’s ass. In the dark hole in the wall, a pearl of precum dripped out of Ben’s cock.
John came back with bowl of tomato soup and a grilled cheese sandwich. The smell of tacos when John got up earlier had made his stomach growl, and he wished he would have gotten more food than this. But he couldn’t complain. John had to spoon feed him the soup, and he tore the sandwich into small bites to drop into his mouth. Didn’t want to get the rest of the chair dirty. He then let Ben gulp down a glass of water.
Without asking if he was satisfied, John sat right back down in the chair. He had a devilish smile on his face, because he had been holding in more gas since he got up.
PRRPTRTTTTTTTTT
The fart sounded like it came from deep in his bowls. Again, he felt the chair jerking around under him. He continued to watch TV.
Close to 10pm, John turned the TV off and got up. He went into the bathroom, got undressed, and turned on the shower. He stood outside, waiting for the water to get hot. His body was covered in black hair, especially on his arms, legs, and ass cheeks. He got into the shower and started to shampoo his hair. He rinsed, put in some conditioner, and lathered his hands in body wash. He kept his ass sticking out of the shower curtain. He didn’t want a single drop of water to touch it. Why wash your ass in the shower when you had a chair with a built in asshole cleaner? Out of curiosity, he did two things. First, he brought his ass back into the shower, still away from the water, and ripped a fart. It echoed off the tiles. He sniffed the air. It was like old cheese in rotting egg salad. The stink actually made him gag. He started laughing. That was what he would be feeding his chair for the next few days. His cock was hard, but he decided to wait to take care of it.
The second thing he did, after he dried himself off, was to rub his index finger in his ass crack, then bring it up to his nose to smell. Not atrocious, but not...good. It’s a man’s ass at the end of the day, of course it wouldn’t smell good. Again he shivered. He washed his hands, then he brushed his teeth. He went into his room, still naked, and grabbed a blanket. Then he walked back to the living room.
His cock had gone down a bit, but it was at half mast when he reached the chair. Briefly, he looked into Ben’s eyes, before turning around and sitting down. Now he felt the skin of his face wedge into his ass crack. Luckily he didn’t have to repeat the rule about nudity, because the chair remembered to start licking. John draped the blanket over himself, and opened a book he had left on the table.
For the next few hours, John was in ecstasy. It was so warm and comfortable. He loved the feeling of being fresh out of the shower, comfy and naked in a blanket, curled up with a good book, and feeling a hot moist tongue work his asshole. It was hard for him to focus on the book, because, despite how much he wanted to dehumanize and ignore him, Ben was the only thing on John’s mind. He thought that at any moment, he could easily fart into his mouth. But it was still day one, John thought he’d give him a bit more time to get used to these arrangements before he pushed the boundaries. The devil on his shoulder was excited. He couldn’t wait until tomorrow, when he would get to hear his chair gagging on the fart he’ll rip down its throat.
As the hours passed, the tongue was moving slower and slower. There were a few minutes where it stopped completely. John would clear his throat, and a moment later it would start back up again. He looked at the clock. It was nearing 1am.
8 hours had passed. Another 40 to go. John wished he could just fall asleep in his chair, and force Ben to endure his night farts. His dick was hard at the idea of him being fast asleep, and his unconscious body letting out a disgusting fart right up Ben’s nose. So badly, he wanted to sleep on top of Ben, keeping Ben from sleeping and forcing him to be conscious with his putrid asshole over his nose. But unfortunately, John couldn’t fall asleep in a chair. He had to lay down. So, he put the bookmark in his book, set it aside, tossed the blanket off of him, and got up to go to bed. He stood up a bit, his ass hovering just over the chair. Instead of saying goodnight, he grabbed his ass cheeks, spread them, and pushed,
PPRRPRPRPRRRRRR
Yet another obnoxiously disgusting fart burst out of his ass. This time, he got to hear the chair’s coughing and gagging without being muffled. He didn’t turn to look. He turned off the light and left the room.
In bed, John had lotioned his cock and was masturbating to the memories of the day. He was kicking himself for not modifying the couch instead. If he’d modified the couch, then he could have the option to sleep with his ass over Ben’s face. Ribbons of cum draped his body. He wiped it off with a rag and fell asleep.
…
At 7am, John’s alarm went off. He yawned, stretched, refreshed for a new day. He got out of bed and threw on tight athletic underwear that helped him breathe down there, grey jogging shorts, and a tight purple running shirt. He put on black socks, and his running shoes.
Walking through the house, he passed the living room on the way to the kitchen. His chair was silent. He grabbed a water bottle out of the fridge, grabbed his iPod, and left his house.
Even though it was a cool morning, he sweat a lot during his run. He jogged three miles every morning. His stomach wasn’t feeling good. Still upset from the cheese the night before. But that was a problem for his chair to deal with.
It was closer to 8am when he got back to the house, his back, armpits, crotch, feet, and ass were all sweating. He finished his water and came into the house, where he took off his shoes, and, with a smirk, dropped his jogging shorts. His underwear had dark patches of sweat around his ass crack and crotch. He walked straight to the living room, ready to relax in his chair.
Briefly looking at the face in the hole, he noticed bags under his eyes. He thought about asking Ben if he slept well, but remembered that it would be weird for a guy to talk to a chair. Ben hadn’t slept well at all. He never was able to sleep on his back, and hours of the straps digging into his skin made him itchy, and the inability to move made him claustrophobic. He briefly slept for a few minutes at a time, dozing off then waking up again, unable to fall into a deep sleep.
John twisted around and sat on the chair. His tight underwear held in the moisture of his ass crack sweat up against the nose. John leaned forward, scrolling through social media on his phone. He slowly let out a thick and silent fart. It made his swamp ass heat up, and again he heard and felt retching under him. John’s cock tightened.
After a half an hour of aimlessly looking at sensationalized news, John got up and went to the kitchen to make breakfast. He scrambled some eggs and put them in an english muffin sandwich, each with a slice of ham and muenster cheese. He figured the combination of eggs and cheese would make a wonderful cocktail of gas for his chair to enjoy later.
He went to the living room and asked, “Hungry?”
“Yes sir,” the chair’s voice croaked, sounding depressed.
John went back to the kitchen. A few moments later, he came back with some buttered toast, a cup of greek yogurt, and a banana cut in slices. Feeding was the only time he treated Ben like a person. John looked down at him with a kind smile.
After giving him a glass of water to drink, the chair said, “...I’m sorry John but I feel so stiff. Can you let me out?”
John’s smile disappeared.
“Just five minutes and I’ll get right back in,” the voice was shrill, “Please, I gotta stretch man, this hurts,”
John didn’t say anything. He set the glass down, stood up, and left the room. Ben’s eyes frantically shifted, but he shouldn’t move his head to see anything beyond the ceiling. He heard John’s footsteps come back, and then, to Ben’s surprise, he felt the gurnee lower. He was going to let him out!
“Thank you so much sir,” he smiled, “I promise I won’t complain again for the rest of the weekend,”
John moved the chair out of the way. But instead of pulling the gurnee out of the wall, he stood over Ben and twisted his ear. Ben cried out in pain, his face scrunching up and his mouth wide open. Just what John wanted. John quickly shoved something into Ben’s mouth, and quickly wrapped a strap around the back of his head, keeping it secure around his mouth. Ben couldn’t see it, but he could feel it prying his lips open. He couldn’t close his mouth if he wanted to. He moaned out, frantic. What was going on?
John ignored his cries, and he brought the chair back over him. Then, he reset the gurnee to lift him back up to seat level. Just like before, except this time his mouth was being held open with a spider gag.
The chair continued to moan in fear as John went into the kitchen and pulled out a half pint of chocolate milk. He chugged half of it, then carried it into the living room. He stood over the chair so it could see clearly what he was holding. It’s eyes were wide with fear. It moaned out, unable to make words but the pattern was clear, “No, no, no, no,”
“I told you I would stop being nice if you didn’t keep silent,” John closed his eyes, setting the milk jug down. “Now, you must be punished.”
He turned around, peeled his underwear off his sweaty ass cheeks, pulled them apart, and sat down on the chair.
PRRRRRRRRRRRRRRRRRRRRR
The chair screamed up John’s ass. John smirked. That had to taste bad. It would take another hour for the milk to do havoc on his system, so he would just have to wait until the real punishment started. John turned on the TV and relaxed.
…
At 11:30, John finally stood up. He looked down at Ben’s face, which was wet with tears, and his eyes were burning red. Despite how horrible the past three hours had been for him, he at least managed to swallow every single fart.
Without speaking, John lowered the gurnee, moved the chair, and then removed the spider gag. The chair didn’t speak. Just like a good chair should act. He then put everything back in place.
John hoped that Ben finally understood what ‘you have no rights” means, and "you belong to me for the next 48 hours”. He looked at the clock and did a quick calculation. 20 hours in, only 28 more to go.
He went into his bedroom and changed into jeans and a plain sweater. Grabbed his coat, wallet, and keys, then left the house. He drove to the grocery store. It was busy around lunch time. He picked up snacks for tonight’s game. Buffalo chicken wings with blue cheese dipping sauce. Nachos. Mozzarella sticks. John grimaced. The milk he drank earlier was making him feel bloated and queasy. As bad as he felt, at least he didn’t have to experience dozens of his lactose farts directly on his tongue. He shuddered at the thought. Even so, he felt reluctant to get all of these cheese products. He shrugged. He always took one for the team. If his friends were over, he’d treat them to all kinds of unhealthy cheese covered snacks. And again, it isn’t as if any of them would have to smell his farts. That was the chair’s job.
He bought a case of generic beer. Then, he decided for himself to grab a six pack of stouts. These heavy dark beers made his ass bloated at night. Since it’s day two, he should bring out the big guns and make full use of his fart-vacuuming chair.
When he got back home, it was a little after 1pm. While he was gone, Ben managed to doze off a bit, only from exhaustion. And boredom. The worst part of this weekend so far was the incredible boredom he felt.
John put everything away, and he left the wings in the oven on low heat. He came back with lunch for the chair. Just a ham sandwich. As he fed the chair, he said out loud, “My friends will be coming around four. I’ve been feeling so bloated and gassy today. Thankfully my new chair will take care of that. I’ll let them out silently, and it will silently vacuum up my farts so no one has to smell them.
The chair let out a whimper.
…
By the time his friends came, John had changed into sweatpants and a loose comfortable sweatshirt. Matt and Hugo gave him bro hugs, and they all walked toward the living room. From their view, the chair was plain as ever, a normal looking seat, unremarkable and not worth looking at twice. John had already set up the nachos. They all grabbed beers, John opted for his bottle of stout. He sat down in his chair and relaxed, taking a deep swig of the bottle. The three of them chatted about work, Hugo vented about his girlfriend, they watched the game and talked about stats, they munched on nachos, they made dirty jokes. John felt his stomach cramp a bit, and so he carefully let out a silent stream of gas. It felt very hot, and it warmed up his butt and the seat of the chair. The heat went away quickly at least. The chair was working. John smiled.
Later, he got up to bring in the wings. As he got up, he smoothed out the sides of the chair to fix any suspicious indentations. For a split second, the seat seemed to be in the shape of a human face. But neither of the friends noticed, because, well, why would anyone pay attention to a chair? In the kitchen, John pulled the wings out of the oven. His stomach still felt sick. The milk from earlier was still bothering him, plus the new addition of nacho cheese. The beer wasn’t helping, and if he dipped fried chicken wings into a cheese sauce...He closed his eyes. It would be very hard for him to hide his gas. But he had to be a good host.
The night went on, and the more drunk they got, the louder they got. They laughed, they cheered. John was so comfortable in his seat. He slowly let out what felt like the hundreth fart of the night. Again, he felt his ass warm up. And again, he felt the slightest nudge underneath him.
“Dude should you be eating all this cheese?” Hugo asked.
Matt laughed, “Oh yeah, doesn’t this shit give you like mad farts and stuff,”
“Hah, yeah,” John shrugged, “To be honest I’ve been farting into my chair ever since I sat down.”
They all started laughing. He went on, “Seriously, it isn’t even like a bunch of farts, for the past hour it’s been one long stream of gas. I’m still letting it out.”
Hugo was on the verge of tears.
“Don’t worry, my chair’s been absorbing it all,”
…
After the game ended, they sat in the living room, chatting some more. Finally, it was nearing 10pm, and they decided to head out. “You wanna come out to Nico’s with us?” Their favorite bar.
“Nah, I’m good. I’ve been exhausted I think I’ll just watch some TV then head to bed.” And he genuinely was feeling sick to his stomach.
He saw them out. Then he returned to the living room and stretched. He saw that he forgot to adjust the fabric the last time he got up, and so the indentation of a face was clear on the seat. John was surprised that none of them had noticed. His dick was getting hard. He walked over to the chair and took the fabric off. Ben took a gasp of air.
“Thirsty?”
“Yes sir,” he coughed.
He went to get a glass of water. He wanted to congratulate Ben on a job well done. Five hours worth of farts went completely unnoticed because of him. But it would be strange to thank a chair for doing something it’s supposed to do anyway. And it isn’t as if a chair would feel something like pride in being a fart absorber.
After giving Ben some water, John sat back down. His eyelids were heavy. He watched the TV some more. He realized he was falling asleep. He got up, went to the fridge, and pulled out the fourth bottle of the night. Not a whole lot, but enough to make his body feel heavy. He got an idea. He was trembling with excitement, but he couldn’t think about it too much or the plan wouldn’t work. He opened a drawer and took out a roll of duct tape. Back in the living room, he set the bottle on the table next to his chair. Then he pulled out a strip of duct tape, and used it to cover the mouth in the chair. Then, he turned around, and slowly lowered the back of his sweatpants. His hairy ass hung out of his pants, and he slowly sat down on the chair, adjusting so that his hole was over the nose as usual. He yawned. He drank the beer and watched the TV, lowering the volume. After another hour, without trying he fell asleep.
…
It wasn’t until the early hours of the morning that Ben realized, with horror, what had happened. That John had fallen asleep with his disgusting unwashed asshole against his nose. Without being able to open his mouth, he had to breathe through his nose, which meant he had to take in his stink with each breath. The weight over him made it difficult to breath as it was.
When he first farted, Ben thought that John was awake. The fart made his eyes burn, and he gagged against the duct tape. Then he realized that John was completely asleep, and that he just farted in his sleep. They were soft, but thick and hot and swampy. The combination of lactose, beer, and deep fried foods, made the stink beyond atrocious. Another fart seeped out of John’s ass. Ben gripped the sides of the board, and wiggled his feet, and tried shifting his body around. There had to be some way to turn his head to the side so he didn’t have to suffer it. But everything had been planned out too well. There was no escape. The asshole was providing him his only air, and so it was the only thing keeping him alive through the night.
…
At 7am the next morning, the alarm in John’s room went off. He could hear it from the living room. He had a bit of a headache, and his mouth was dry. He saw the TV was still on, low volume. The morning news. He drifted in and out of sleep for a bit.
Almost half an hour later, he opened his eyes again. He felt sweaty. Uncomfortably sweaty. It was warm in this room, and the sweat clothes were really making him sweat. He knew his hairy ass was coated in sweat, and the face pressed up in his ass crack also felt uncomfortably hot. John smiled. He couldn’t imagine how horrible the night had to have been for his chair. He grunted and let out a beastly morning fart.
PPPPTPRPTRPTRPTRPTRPTPPSSSS
Yep. Definitely a beer fart. He felt shifting underneath him. Good, his chair survived the night. He stayed there for a bit so the chair could absorb the gas.
He stood up, peeling his cheeks off the face, and yanked the duct tape off. The chair cried out in pain, and then started gasping. John ignored the noise and walked to his room, his ass still hanging out, red marks from where it had been rubbing skin all night.
He took off his clothes, went into the bathroom, and took another shower. Again, he kept his ass out of the curtain. He thought it must have looked funny from an outsider perspective; a man taking a shower with his ass sticking out.
Usually he went for a run, but he wasn’t feeling good. His stomach was still a wreck from the night before. Only 7 more hours of fun. He didn’t put on a shirt, but he did put on a pair of basketball shorts.
He went back to the kitchen and made a bowl of oatmeal. He fed the chair without speaking to it. The chair didn’t say anything, it greedily ate the oatmeal off the spoon. Even though John knew it would make him feel worse, he poured himself a bowl of cereal with milk. He brought his cereal into the living room and ate it while watching the news from his chair. His stomach hurt in the next half hour.
SSSPPPPPPPRPRPRRPRPRPRR
The fart was painful, and sounded ugly. John cringed and held his stomach. He wanted to take one of his emergency gas pain relief pills, but that would probably stop his gas for the rest of the day. He only had 6.5 hours of fun left with his chair, and he wanted to make it happy. So he bore the pain, and pushed out the next fart.
PPRRTTRTRTRTRPTPRTPRTPRTPRTPRPTRPTPRTP
The chair was working overtime to suck in these farts. John was surprised he still felt and heard gagging underneath him. You’d think after so much time, the chair would get used to it by then.
A wicked thought came to John’s mind. He’d had it before when he first messaged Ben, but he didn’t take it seriously. But he thought, what if he just decided to keep his new chair, and ignore any previous arrangements. Of course the thought was just a fantasy, he couldn’t actually do that to Ben. But it made his balls tighten.
…
He didn’t do much the next couple hours. As usual, he watched TV, and unleashed his upset-stomach farts into the seat of the chair. He couldn’t imagined what they must have smelt like. And thanks to the chair, he would have no idea.
At lunch, he just had a sandwich. He fed the same type of sandwich to the chair, and gave it water. Then, he sat back down. He watched reruns. He yawned. It was pretty boring to just sit in a chair all day, but he wanted the chair’s last hours to be full of farts and ass stink.
The clock eventually struck 3:30pm. Only 30 more minutes. The chair had done a fantastic job today. Unlike yesterday with all of its shaking around and moaning and speaking, the chair was completely quiet, and barely moved. It didn’t matter how loud or long or rank the farts were, the chair silently took them in. Again, as John’s heart was pounding, he pulled his pants down and sat back on the chair with his bare ass. He felt the tongue wiggle up his hole immediately. He started to jerk off, his throbbing cock large in his hand. His balls felt swollen. He knew he was going to cum soon, so he had to make it count.
He tried imagining what it was like for his chair the past two days. How endless the assault of farts must have been for its nose. How uncomfortable its body had to be in the straps. How it had no way of knowing the passage of time, and could only see, feel, and smell the ass that was resting on it. How bad his ass stunk from the farts and from not washing. And how the chair licked his asshole without protest.
He felt a fart and ripped it onto the tongue and into its mouth.
PRRRR
The tongue recoiled for a moment, then kept going.
John came. His asshole clenched over the tongue that was rimming him.
He settled down, his heart beating, and feeling light headed, as the tongue kept probing his asshole. The clock read 4pm, but he spent a few minutes relaxing in the afterglow.
“Alright then,” John sighed in disappointment, “Time’s up.”
He stood up. Ben let out a sigh of relief. John lowered the gurnee, and moved the chair out of the way. Then, he pulled the gurnee halfway out. He undid the hoses and tubes around Ben’s privates. Then he pulled the gurnee out. Ben looked pale, limp, and miserable. Especially in his eyes, there was such misery and exhaustion. His cock was rock hard.
“I don’t normally do this to guys,” John said, “But you deserve a reward for being such a good chair,”
He dropped his pants, and straddled Ben, lowering his asshole over his face, smothering him. As he sat on Ben, he watched as his body buckled around. John grabbed Ben’s rock hard cock, bent over, and took it into his mouth.
Ben had been rock hard for so long, that he felt his dick was sensitive enough to go off at the slightest friction. At least, that’s what he thought would happen, if he had any physical stimulation while he was down there. It only took him a minute to erupt cum into John’s mouth. He moaned into John’s ass.
Then, John stood up and undid the straps. Slowly, Ben moved his joints around. When John got to the headboard and undid the strap and posts, Ben cracked his neck loudly. Like a sloth, he tried sitting up, his full body was fatigued. Red lines from where the straps were raced across his skin.
“Well...how was it?” John smiled.
“That was fucking horrible,” Ben muttered.
“Oh,” John frowned, “I’m sorry it wasn’t what you hoped it would be.”
“Fuck off, where’s your bathroom, I need to shower.”
…
John drove him to the train station that evening. In the car, just before Ben left, he said “Well, even though you didn’t like it, thanks for helping me live out this fantasy.”
“Whatever,” Ben’s voice was low. He got out of the car and headed for the train.
…
On the train ride, Ben looked depressed. He thought through everything he’d experienced. How badly John’s farts stink. How uncomfortable it was to be strapped down. How humiliating and disgusting it was to relieve himself in a hole in the wall. His full body was exhausted and stiff with pain from laying on the board for so long. And John didn’t even have the decency to let him stretch once. He remembered how boring it was to just lay there quietly, passively taking farts to the face, and then staring up at the ceiling when he was away. He had constant headaches from exhaustion and the pressure of John’s body. He felt underfed and cranky from the small bland meals John made for him. And worst of all, he was constantly nauseous when John farted into his nose. His throat hurt from so much coughing and gagging. And when the farts were very bad, he would jerk around and the straps dug more into his skin, making it burn.
He’d turned down going with his friends to a bar that weekend for this. He’d chosen to spend two days of his life like this. He felt so dirty and pathetic. And embarrassed. He had been so excited to try out bondage, and his fart fetish, only to hate both in the end.
That night, he was laying in bed, and he thought about John’s ass, how bad it stunk, how gross it felt sweating on his face, how the hairs clung to his nose and made it itch.
Despite how much he’d hated the experience, his cock was rock hard. And cocks usually don’t lie.
He called John.
“Hello?”
“Hey John, it’s me. Ben.”
“Oh...hey. What’s up?”
He took a deep breath, “That was the hottest thing I’ve ever done. I loved it so much.”
“Really? You sounded so mad after I let you out,”
“Yeah but…” Ben couldn’t explain, “I can’t stop thinking about your asshole.”
“Oh well I’m flattered, haha,”
“Are you doing anything this weekend?”
On the other end of the line, Ben heard John laughing.
(Contains hypno if you're into that)
Ugh doing interviews is such a pain. The recent promotion was worth it for the pay rise but didn't make the job hiring any more fun. Luckily this was the last one of the day. You ordered your new secretary to send the final guy into your new office and you sat back in your clean new chair feeling happy with yourself.
You heard the door open and you didn't even want to look up.
"Hey, take a seat, I'm just finishing something." You dragged your mouse around pretending to do anything just to set up a power dynamic.
"Ah well I have places to be." You registered the snide retort as you heard him sit down. You looked up at the other guy staring back at you. He seemed familiar but you couldn't place it.
"Do I know you?" You bluntly questioned.
The guy smirked. "Yeah we were in high school together, don't think you were a big fan though." You stared back at this confrontational guy and picked up on his well groomed appearance. Oh shit he was that gay kid, yeah you kinda bullied him a bit but damn that was years ago.
"Ah well we're adults now," you tried to take a professional tone, "so you're looking for a job here?" You weren't in the mood for apologies.
"Oh wait before that." He cut you off before you could elaborate adjusting his position in his chair crossing one leg onto the other and lifting his butt up a little.
PPPPPPRRRRRRAFFFFFFTTT
The undeniable sound of a fart blew out into the chair and diffused into around the room.
"Phew that was a stinker!" He relaxed back into his chair taking a big sniff. So much for professional you thought covering your nose with a handkerchief. This didn't do much however as you'd already gotten a noseful of the interviewees cheesey stink.
"Not making a great first impression here." You condescendingly raised your eyebrows at the smug looking man.
"Are you sure, I think the stink is gonna go down a storm." He winked as he lifted up his ass again making you grimace.
BBBBBBRRRAAAPPPPPTTTTTTTTT
"Whew gotta love it!" The man took another inhale of the putrid smell which was tainting your once fresh office. You unfortunately got another whiff yourself and the rotten smell even got in your mouth making you wretch.
"What kind of weird revenge, I'm calling securi-"
"Nuh uh!" He got up cutting off your threat and bent over pointing his ass right over your desk.
FFFFFFFFRRRRRRRARRRRRRPPPPPPPPPPP
The blast blew your hair back and it was the worst smell yet making you gag and unluckily breathe in a massive amount of flatulence. And just then your body began to feel sluggish.
He leered back over his stinky ass at your plain expression. "Ah third time's the charm." He chuckled.
You willed you arm to reach for the phone but your body wouldn't move. Your mind was racing but you had lost all control of your physical being. Your former classmate was now sitting on the desk ass pointing at you as he smiled down at you.
Pssssssssshhhhhhhhhhhhhhhh
The hot quiet rush of stink was aimed directly at you forcing you to suffer in silence unable to hold your breathe. "Ah when you torment people in high school I assume you never take into account mind-controlling farts but here we are?" He laughed down at you. You could tell he could see the suffering in your eyes based on his malicious gaze. "Whew and such a toxic brew as well!" He wafted the seemingly never ending SBD in your direction while leaning over to get a good sniff himself.
He stood up finally cutting off the fart. It seemed like your office was now hazy from the rancid smell permeating every corner. "Okay let's switch seats, its my turn to interview!" He playfully smiled as he watched you pull yourself up and walk over to the other side of the desk and sit on the polluted chair. It was a horrific sensation, you could still experience every sense perfectly, unfortunately smell included, but you were in control of none of them. You moved as you normally would but it wasn't you doing it, it was like someone was playing you in a game.
"Yeah it is scary, but you deserve it." He broke his playful tone giving you a much more serious look. Could he read your mind or was your fear just that obvious. "And no I can't read your mind, fart sniffing slaves like you are just easy to read." You wished it would wear off but no matter how much you willed it you weren't moving.
"Your company posting your promotion really was a death sentence for you." He sneered at your mournful eyes. "Which is why I've got an even better position for you." He reverted back to his maliciously playful tone. "So first your gonna walk out of here and say that you're quitting from the stress, then you're going to call your family and say that you've always been gay and you're moving far away to live with the man of your dreams." As he began to give the orders your eyes trembled. What kind of hell was this? Could he really make you do all that? "But of course that's not true, after selling all your assets and transferring them to me you'll need something to do!" He grinned evilly, your heart was sinking so deep it felt almost as painful as your stinging eyes and intoxicated lungs. "So since your face looks so comfortable I think you'll serve a much better purpose in this world as my fart cushion!" He seemed ecstatic to inform you of your fate while you wished for this nightmare to be over. "Any of my foul fragrance which I think needs a second set of nostrils to appreciate will be yours to sniff." He rubbed his stomach. "So how about a trial shift to finish this interview?"
He stood up once more and turned around. "So you want the job?" Everything inside you was saying no but the potent pheremones controlling you thought otherwise.
"Of course!" Your voice replied eagerly and your face twisted into a subservient smile as your body climbed over the desk and you nestled your nose between his tightly covered cheeks. This was when the level of control he had over you sunk in. This was real. The maniacal laughter coming from your new boss solidified it.
"Ah don't worry the first day on the job always stinks!"
BBBBBBBBBBRRRRRRRRRRAAAAAAPPPPPPPPPPPPPPPPPPTTTTTTTT
-
ko-fi if you wanna tip or make a commission