Dec 28, 2023
NGN!!
Next generation network?
Or amino acids
N-G-N Asparagine-Glycine-Asparagine
I have found a protein with several NGN repeats in Haliotis asinina, is that what you meant? Does that mean you are indirectly calling me an 'ass'?
seen from United States
seen from China
seen from Canada
seen from Yemen
seen from United States
seen from Indonesia
seen from China
seen from China
seen from United States
seen from United States
seen from United States
seen from United States
seen from United States
seen from Japan
seen from Singapore
seen from United States
seen from China
seen from China
seen from Argentina
seen from China
NGN!!
Next generation network?
Or amino acids
N-G-N Asparagine-Glycine-Asparagine
I have found a protein with several NGN repeats in Haliotis asinina, is that what you meant? Does that mean you are indirectly calling me an 'ass'?
Secreted Frizzled-Related Protein 1: Sequence
MGIGRSEGGRRGAALGVLLALGAALLAVGSASEYDYVSFQSDIGPYQSGRFYTKPPQCVDIPADLRLCHN VGYKKMVLPNLLEHETMAEVKQQASSWVPLLNKNCHAGTQVFLCSLFAPVCLDRPIYPCRWLCEAVRDSC EPVMQFFGFYWPEMLKCDKFPEGDVCIAMTPPNATEASKPQGTTVCPPCDNELKSEAIIEHLCASEFALR MKIKEVKKENGDKKIVPKKKKPLKLGPIKKKDLKKLVLYLKNGADCPCHQLDNLSHHFLIMGRKVKSQYL LTAIHKWDKKNKEFKNFMKKMKNHECPTFQSVFK