L'attrape-rêves

Everything that turns my eyes on

[shiftythrifting]

Submission from sinclaire: I probably should submit the mannequin vault at my local thrift

[thegaymertrainer]

[spicychickenfingerings-deactiva]

[pvttaria]

[catchymemes]

[protein-shake-king]

[protein-shake-king]

[daily-spooky]

[very-gay-alkyrion]

[protein-shake-king]

[protein-shake-king]

[d4rkerthanbl4ck-deactivated2025]

This will never not be funny to me.

[radicalgraff]

"A world without trans people has never existed and never will"

Poster spotted in Olympia, WA

[filmgifs]

Richard Allan as Patrick in Niagara (1953) dir. Henry Hathaway

[pierppasolini]

Delivery Boys (1985) // dir. Kenneth Handler

[ashenmind]

god if there was a book of forbidden spells I wouldn’t even hesitate

[yvesceline]

Thierry Mugler, 1995.

[coughloop]

i will....