hodaya

✨when it rains, it pours ✨ ask box is open, go ahead <3 my words, yep, everything you see here.

[superstarhodaya]

Let’s normalize not knowing what you want to do in your life even when you’re not a kid anymore

[thoughtkick]

“There is always a chance to change and make things right.”

— Unknown

[tenderwatches]

sometimes you need dialogue tags and don't want to use the same four

[dionysiaproductions]

[thoughtkick]

“You know who’s gonna give you everything? Yourself.”

— Diane Von Furstenberg

[lilianne-tarot]

Pick-A-Card: What Makes People Secretly Jealous of You✧˖°.

How to Pick Your Pile: Take a deep breath, clear your mind, and look at the images above. Which one pulls you in the most? Trust your gut! Once you choose the image, The number below your chosen image is your pile. If more than one catches your eye, that just means there’s extra tea for you, go ahead and read both!

✰ If you enjoyed this reading, get your own personalized paid reading here!😊🦋

✰ For personalized 18+ readings, click here!

✰ My Ko-fi link: here 🫶🏻

✰ My Masterlist🫶🏻

⋆. 𐙚 ˚ ˚ PILE I

cards pulled: 5 of swords, 4 of swords, page of wands, 6 of swords, knight of swords, 3 of swords

Okay PILE 1, UHM… instantly, you’re giving main character energy in a way that intimidates the sh*t out of people. Like you’re not even trying to be the center of attention, but somehow you always are? You enter a space and people are like, “Who do they think they are?” while also copying your stuff three days later. You walk with a silent type of confidence, very “don’t test me” energy. People sense you’ve had hard times, and even if they don’t know the details, they can feel it. You’ve got this inner toughness that’s kind of scary hot tbh. Your vibe is a whole psychological thriller. Like, folks don’t know whether to admire you, kiss you, or block you for their own emotional safety 😂

You probably learned the HARD way not to overshare. You likely had friendships that ended weirdly, conversations that drained you, people who twisted your words. And now? You’ve mastered the art of being unreadable but piercingly observant. This group is in their “🧠 > 🤡” era( I SAID WHAT I SAID😭) . You don’t argue. You just watch, process, distance yourself, and transform yourself in silence. THIS. This is the part that has people frothing. You’re unbothered. People can literally throw tantrums, shade, or even subtle digs at you, and you’ll be doing your own shit and minding your own mental health. You’re the kind of person who pulls back, protects their peace, and doesn't give people the satisfaction of a reaction. And bestie, THAT is maddening to people who need chaos to feel relevant. You choosing silence? You choosing yourself? You resting instead of people-pleasing? People cannot handle how you don’t chase or cling or overexplain. Your energy says, “If you cross me, I’ll just go leave, idc.” And that’s more threatening than any clapback. Them not feeling worthy enough is what piss them off

Ugh, I love this for you 😭 i sense this is youthful fire. Like, your curiosity, your passion, your spark, it’s infectious. Even when you’re figuring life out, you make it look like an adventure. People wish they had your sense of excitement, your ability to find beauty in the unknown, your passion projects, your spontaneous glow-up moments. You still believe in magic, and you chase it. People see that in you and lowkey get anxious sometimes which in turn leads to anxiety. You remind them of who they used to be or who they wish they were. You’re like their inner child’s inspiration and trigger at the same damn time 😭

 If you ask how this jealousy shows up? Okay bestie, here’s the deal, they LEAVEEE. that's it....Like, people who get too jealous of you will slowly drift, ghost, or distance themselves. And it’s not because you did anything. Nope. It’s literally because your energy is a mirror, you unintentionally expose what they’re running from in themselves. So when someone exits your life out of nowhere? It's not always shade. It’s often that your growth, your self-protection, your refusal to settle… it gets too loud for their comfort. And some of them might even act like you’re "too much" or “hard to connect with” but that’s just projection, babe. They’re mad you're moving on, moving forward, and not looking back.

AND THIS is your sign to stop holding back. You’ve got things to say. Projects to create. Movements to spark. Opinions to express. And the universe is screaming at you to stop playing nice just to make insecure people feel comfy. You’re meant to lead. You’ve got clarity that cuts through the fluff, and people NEED that. You’re not here to be palatable; you’re here to be powerful.

Okay  big hug 🤍 because this tells me your power didn’t come from sunshine and luck, alteast not always. It came from heartbreak, betrayal, disappointment. Like… people don’t get that your confidence is built on grief. You’ve transmuted pain into power. And while they’re busy watching your highlight reel, they have no idea you cried yourself into this version of you. That’s the hidden jealousy no one talks about, how you kept going when others would’ve collapsed. That’s the real intimidation.

 I’m getting an oddly specific message: some people from your past (school friends? old internet mutuals?) STILL stalk you online. Like, they swear they don’t care, but they’re obsessed with the way you keep evolving. I even saw someone in my mind writing a note like “they always bounce back.” LMAO not them studying you😭

Stay sharp, baby. You’re meant to trigger AND inspire 💅🔥

Liked the reading? get your own personalized, super detailed reading HERE!

⋆. 𐙚 ˚ ˚ PILE II

cards pulled: the world, 9 of pentacles, ace of pentacles, ace of wands, queen of wands, 3 of swords

OMG okay wait PILE 2??! Babe… you’re not even walking into rooms, you’re making whole room shift when you show up (okay maybe a little exaggeration but i feel that way so i said it) 💀 but honestly, to me, This pile is aura-too-bright-for-this-world energy. The cards here?? ICONIC. 

So right off the bat, with The World as your “vibe that catches attention instantly,” I audibly gasped. No, seriously ’m seeing someone who’s got that complete package aura. Like… when you walk into a space, people instantly sense that you’ve seen life, evolved, and you’re not here to play. You feel like someone who's been through seasons, leveled up through pain, and came out looking expensive, composed, and unbothered. There’s this whole “I’ve arrived” energy that surrounds you. It's not cocky it’s earned.

And paired with Nine of Pentacles + Ace of Pentacles + Ace of Wands + Queen of Wands, like… WHAT EVEN IS THIS POWER COMBO?? Bestie, you are literally the embodiment of “I’m secured, unshakable” I’m seeing you as someone who might have had to glow up alone. People ditched you during your struggle era.People are so jealous because you make independence look luxurious. And this isn’t fake rich aesthetic energy, it’s like… you actually worked for the stability you have now. Financial glow-up? Check. Confidence glow-up? Check. ENERGY glow-up? Baby, it’s off the charts. For people who havent yet received any of these, just wait lovelies, you are soon reaching that level! You come off as someone who doesn’t need anyone, but also, anyone would kill to be needed by you. your creative spark is lit as hell right now. You probably have 10 ideas swirling in your head at any moment. You’re the kind of person who creates something new out of nothing, and just have oodly specific magnetic quality. People can’t stop watching you like they’re not even sure why they’re drawn to you, but they are. You might post the most random thing on social media and get a hundred saves. It’s THAT type of energy. You intimidate people without trying. You could be in sweats and people are still clocking you like, “Who is THAT?” You walk in like a flame in a room full of plastic candles. I’m not gonna lie some folks deadass want your confidence, your glow, your ability to just own yourself. And they try to copy it, but it doesn’t hit the same because theirs is curated. Yours? Authentic AF.

BUT THEN… BOOM. We get hit with Three of Swords and oof. That changes the whole flavor of this pile. This is the secret ingredient in your power. People don’t realize that the reason you shine so hard now is because you had to crawl through heartbreak, betrayal, rejection, and emotional hell just to find your light again. Like, this is NOT surface-level sadness. This is “I had to rebuild my damn self when everyone left” energy. Your glow comes from grief you survived. Your confidence was carved out of loss. And people feel that even if they don’t consciously get it.

Let’s talk about how this jealousy shows up in behavior. Some people act fake supportive. You’ll notice them almost hyping you up, but it’s giving “I’m clapping, but I’m also watching to see when you fall.” Others might straight up ghost you the moment you succeed at something. Like, why is it crickets when you’re winning?? 😭 Some people are so triggered by your glow-up they pretend they don’t see it. You’ll post something huge and they’ll scroll past like they’re blind, but you know they saw it. Oh, they saw it. They’re LURKING. I’m picking up on past friends or even family members who remember you before you knew your worth, are mostly jealous. They don’t know how to deal with you now that you’ve stepped into your power. Also I’m feeling online strangers too. People who watch you, feel inferior, and try to tear you down in petty ways, shady energy, maybe even copying you to feel closer to your vibe. But it never lands right. Because your essence? It’s not copy-paste.

Babe… you’re not meant to be digestible to everyone. Your energy is big, your aura is blinding, and not everyone has the emotional range to celebrate that. Some people will see your light and clap. Others will squint and get mad that it hurts their eyes. That’s not your problem. The World card is reminding you: you’ve already completed one of the hardest chapters. You don’t need external validation. You ARE the moment. Keep planting those seeds (Ace of Pentacles), chase that inspiration (Ace of Wands), stay in your fiery power (Queen of Wands), and remember you’re glowing because you healed through hell. And that’s the real flex.

People aren't just jealous of what you have. they're haunted by the fact that nothing could break you.

Liked the reading? get your own personalized, super detailed reading HERE!

⋆. 𐙚 ˚ ˚ PILE III

Cards Pulled: ace of cups, 9 of wands, judgement, 10 of cups, the sun

OH BABY. PILE 3??? This one has me emotional chaos in the best way possible, like, I’m laughing, crying, cheering you on, and lowkey feeling jealous myself 😭✨ There’s just something so undeniably rare about your energy, and I’m gonna be real with you, people don’t just notice you… they get emotionally activated by you. 

So right off the bat we open with the Ace of Cups as your “vibe that catches attention instantly.” GIRL. The softness. The emotional depth. The actual divine femininity (this quality is not restricted to one gender, it’s about the energy here) . People sense that your heart is open, your energy is healing, and you’ve got this naturally receptive, magnetic glow that pulls people in like you’re the human version of a warm hug and a deep exhale. You give off big “safe space” energy but also romantic, ethereal, dreamy vibes. It’s like… being around you makes people want to open up, cry, confess their life story and then fall in love with you. You’re that person.

And that’s exactly why the Nine of Wands shows up next because people have no idea how hard you’ve worked to stay this soft. You’ve been through so much emotional wounding, maybe abandonment, betrayal, family drama, heartbreak but instead of turning bitter, you became even more radiant. Bestie, you are literally the definition of a wounded healer. Your boundaries are firm now, but you still love so hard. You protect your peace(AS YOU SHOULD), but you’ve also never lost that softness. THAT is your power. You didn’t get cold. You got clear.

Now here’s the fun part: people are jealous as hell of your emotional fulfillment and the fact that you are so deeply in tune with yourself and others. The Ten of Cups and The Sun together?. This is “I’m manifesting the life of my dreams and I will protect my joy with my whole damn soul” energy. Whether or not you have the full picture yet (some of you may still be building it), people look at you and feel like: “Ugh. They’ve got it all.” The dream relationships. The emotional clarity. That sense of “I know what I want, and I will not settle for less.” That triggers people who feel lost, disconnected, or stuck in superficiality.

THIS is the energy that freaks people out the most. Because it’s the card of awakening. You’re someone who constantly reinvents yourself, levels up, and literally triggers people’s consciousness. Like, someone will meet you and a week later be in an existential crisis just from how your energy reflected back all the places they’re asleep in their own life. You don’t even need to say much, your presence alone forces people to confront their emotional blind spots. It’s that deep.

Let’s talk about how this jealousy actually shows up in behavior, because oh honey, it’s sneaky. Some people will love-bomb you at first. They’ll worship you, obsess over you, and tell you that you’re the best thing that’s ever happened to them. But as soon as they realize they can’t match your depth or keep up with your light? Boom. They either ghost you, emotionally shut down, or try to project their pain onto you. Some may even subtly compete with you emotionally, like copying your vibe but making it weirdly performative. Others might act overly critical of your emotions like “you’re too sensitive” or “too idealistic” but deep down? They wish they could feel as deeply and freely as you. I’m picking up on exes, old crushes, emotionally unavailable people, and even spiritually bypassing fake-deep people. They once had access to your love, your softness, your radiance, and now they’re haunted by the fact that they fumbled you. Also, I feel like some parents or authority figures might’ve been emotionally intimidated by how “different” you were growing up. Maybe you felt misunderstood for being so dreamy or sensitive. But look at you now turning your heart into a damn superpower.

Do not water down your light or dim your joy to make others comfortable. The Sun says your happiness is holy. You’re meant to shine, radiate, and live in color, even if that makes other people squint. And Judgement is reminding you: keep rising. Every time you outgrow your old self, people will fall off, and that’s okay. They were never meant to go where you’re headed. Your emotional depth isn’t a weakness. it’s what makes you a fckin force of nature. Keep protecting your peace, pouring love into people who deserve it, and curating a life that feels like poetry. The right ones will meet you there. You’re not just powerful because of your light, you’re powerful because you chose your light after walking through hell. And people will always be a little salty about that.

So go ahead and keep shining, crybaby angel warrior 😭💛 You’ve earned every drop of your joy.

Liked the reading? get your own personalized, super detailed reading HERE!

Thank you so much for reading all the way through! I hope my reading resonated with you and that you had a lovely time going through it. If you enjoyed it, please like and reblog, it really means a lot! Let me know which pile you chose; I absolutely love hearing your thoughts and feedback on my readings! If my reading resonated you, you may consider buying my paid reading as it would really help me out financially♡

Note: tarot cards provide guidance and possible insights into what could happen based on current energies, thoughts, and actions. the cards can highlight potential paths or outcomes, but they do not fixedly predict the future. this is a general reading so take what resonates!

[superstarhodaya]

1111✨💫

[tarotwithavi]

A woman like her does not need a man but most men need a woman like her

How do men view you? What's their first impression of you? How do you make them uncomfortable? (In a bad way ofc 😋)

I’m really sorry for being inactive lately! I recently had an accident that messed up my shoulder, and since it’s been dislocated before, the recovery was a little tougher this time. But the good news is that i’m finally back, and that’s what really matters.

TIP JAR

MASTERLIST

PAID READINGs

┅┅┅┅┅┅┅༻❁༺┅┅┅┅┅┅┅

Pile 1

Okay, so the first message I’m getting is that you are someone who challenges authority and traditions. I feel like many of you come from a background where women were suppressed, where they were expected to stay quiet, submissive, or simply didn’t have enough rights of their own. But you are different (not in a pick me way) you challenge everything that tradition has taught you, and this is one of the reasons why people sometimes feel really uncomfortable around you. You are not afraid of questioning culture and traditions that have been in practice for a very long time. I see that you really value your independence and you do not want to be bound by the rules of society. You are someone who practices feminism and who is not afraid to speak your mind. You openly express your emotions and opinions, even in front of a large group of people. Sometimes you say things that society may not be ready to hear, but that doesn’t stop you and that’s what makes you powerful. Men often see you as someone they cannot control. They know you will question their actions the moment they do something wrong, and that makes them feel exposed. Many men even fear being around you because they realize they cannot have power over you. Your words, your voice, and the way you speak about equality, feminism, and what’s happening in the world, it shakes people. It makes them rethink things, even when they don’t want to.

For some of you, I also see that you may not practice religion, or you might feel very different from your family traditions. You might not completely fit into your family’s culture, and that makes you stand out even more. I sense fear from some men in your circle. They hesitate to talk to you, they hesitate to be too close, because your energy directly challenges their ego. You may also have strong or unusual thoughts about marriage. A lot of men see you as very independent, very straightforward, intelligent, quick-minded, and layered with depth. Your communication style is sharp, you don’t sugarcoat things, you say them as they are, and that honesty makes people respect you, even if they can’t handle it. Another message I’m getting is that some of you might be the eldest daughter in your family, or you might have matured much earlier than your age. Men also see that you’ve been through difficulties, and that you’ve survived battles where the odds were against you. That survival has made you strong, and it also makes men realize they cannot defeat you easily.

You are also very careful about who you let into your life. You don’t allow just anyone in, you keep people waiting, testing their patience, and that alone makes men nervous. I feel like you are not someone who cares about men’s opinions of you. You don’t care how they perceive you, and honestly, why should you? You don’t give a flying fuck about their approval, and babe why are you even reading this pac 😭 you already know the power you have over men. I feel like you trigger a lot of masculine energy. Men never know what to expect from you because your words and presence shake them to their core. It’s like the things you say act as a mirror, forcing them to see the truth. Sometimes, it even feels like their whole ego or false personality crumbles when they try to argue with you.

You might have Aquarius or 11th house placements, or maybe Mars in the 11th house. Some of you could be Libra, Gemini, or Aquarius sun, moon, or rising. You might even be into political science, activism, or politics in general. I also see that you are influential, your words carry power, and you leave an impact wherever you go. Deep down, in your mind, you may even feel like men are kind of hopeless, because they fail to match the standards you set. Some of you may also dress in a way that is not traditionally “feminine.” You may prefer a masculine style, or simply a way of dressing that doesn’t fit what men expect women to look like. This itself is another way you challenge society. And you know what? A lot of girls look at you as an inspiration. They see you as someone they want to become in the future fearless, outspoken, independent, and unapologetically yourself. And honestly, I love that about you. You might like taking part in debates or arguing with men in general lol.

Thank you so much for reading this pick-a-card! 💗 If this resonated with you, don’t forget to show some love by liking reblogging or commenting ✨

TIP JAR

┅┅┅┅┅┅┅༻❁༺┅┅┅┅┅┅┅

Pile 2

Okay, so I do see that men may try to sexualize you a lot. You carry this very sensual, magnetic energy, and many men see you as a seductress, someone who naturally pulls their attention. A lot of them are attracted to you physically, sometimes even obsessively. But at the same time, they also sense that you are dangerous. It’s like they know that being too close to you could ruin their “good boy” image, so they keep a distance. They’re drawn in, but they’re also scared of what it might mean for their reputation. I also see that for some of you, in school or during your teenage years, boys might have spread nasty rumors about you. They may have tried to tarnish your name or say disrespectful things just because they couldn’t handle your energy. You remind me of Marilyn Monroe, someone who was incredibly sensual, but also deeply intelligent and misunderstood. And just like her, men often fail to see the depth behind your beauty. They get stuck on the surface, not realizing how smart, mature, and knowledgeable you actually are.

Some of you might already have a master’s degree, or you are pursuing one you are well-educated, sharp, and ambitious. But many men fail to see beyond the seductive aura. They underestimate you because of how they sexualize you, but deep down, they know you are smarter than them. That’s what really threatens them. I also see that when men approach you with the excuse of “helping you,” many times their real intention is to get something out of you. You’re very aware of this, because it has happened before. As a child or in your early teenage years, you might have been bubbly, kind, and open to help. But as you grew older, you realized that often their “help” came with strings attached. They weren’t doing it from a place of kindness they were feeding their fantasies.

Because of this, you may now hate asking men for help. You would rather do things on your own, even if it means pushing yourself beyond your limits. This has made you fiercely independent, but also someone who carries a lot of responsibility on your shoulders. Men also feel uncomfortable because you are more knowledgeable and capable than them in many areas. Nothing hurts an unhealed man’s ego more than seeing a woman doing better. I see that you might be in a male-dominated field; this could be business, coding, computer science, mathematics, research, or something similar. And you shine there. You do things that men often believe are “their” domain, and that shakes them up completely.

I also sense that you may have lost faith in men, or at least in the idea of finding a “good man” in this generation. It’s not that you’re bitter, it's just that experience has taught you not to expect much. You’ve seen too much disappointment, too much toxicity. Some of you could be Scorpio or Capricorn sun, moon, or rising. You might also have Capricorn/scorpio in your 3rd house or strong 10th house placements. Another message I’m getting is that men don’t just get attracted to you casually they get obsessed. To the point of extreme toxicity. They might stalk, fantasize, or cling to your energy in unhealthy ways. And this is one of the reasons you keep your distance from them. You know their obsession can turn dangerous. You know they cannot handle your power, so you protect yourself by staying selective with who you allow close. You are the type of person who men cannot forget. Even when they walk away, they keep thinking about you. But You’ve built yourself in a way that you don’t need their validation. You’ve already proven to yourself that you can survive, rise, and thrive without anyone’s help.

Thank you so much for reading this pick-a-card! 💗 If this resonated with you, don’t forget to show some love by liking reblogging or commenting ✨

TIP JAR

┅┅┅┅┅┅┅༻❁༺┅┅┅┅┅┅┅

Pile 3

I see that many of you might have an innocent appearance maybe a cute face, soft features, or a sweet way of dressing. Some of you might even dress in a very cute or trendy way, which makes people see you as youthful, playful, or inexperienced about life. You give off really ethereal and otherworldly vibes. Like a fairy. An angel. Now, this is not to “baby” you this is just how many people, especially men, perceive you at first glance. They look at you and instantly assume you are someone fragile who needs to be guided, protected, or provided for. But the reality is very different. I also see that you have already tried to build something of your own. Maybe you’ve started a business, or you’re already doing something that makes you financially independent. You’ve shown that you can stand on your own feet, and that already sets you apart. Men don’t always know how to approach you, because on one side you look innocent, but on the other side, you are stronger and wiser than they expect.

I also see that even though you look young or inexperienced, you carry a lot of wisdom. Some of this wisdom might come from your mother, grandmother, or another older female figure who had a big influence on you. It’s like you carry generational strength inside you, and that wisdom comes out at the right time. Men also tend to see you as a heartbreaker or a “player,” even though you are quite the opposite 😭. Maybe you’ve received a lot of proposals, attention, or admiration, and because of this, men assume you have too many options. They think you aren’t looking for anything serious or long-term, when in reality, you value depth and real commitment. This misunderstanding makes them put you in the wrong category sometimes.

I also see that men notice your physical strength. Maybe you go to the gym, do yoga, exercise, or simply take care of your body. Some of you may even appear stronger or fitter than men in your circle, and this intimidates them. Men are used to using their physical strength as an advantage over women, but with you, that power is taken away and you prove them wrong. For some reason, you remind me of Zoey from Huntrix, someone who is pretty, kind, and creative, but also powerful and not someone to underestimate. Men see you as compassionate, always willing to help others, always kind, but at the same time, they know you won’t let anyone walk all over you. You have boundaries, and you protect them.

Another message I’m getting is that you are very focused on your goals and success. You’re ambitious, and you want to make a name for yourself. You know what you want in life, and you’re not afraid to chase it. Ambitious women scare men the most, because they know they cannot bind or control them. You might even have this belief that you won’t marry until you’ve made your own name or secured a stable source of income. And the reason behind this is simple: you don’t want your future husband or partner to have an “upper hand” over you in the relationship. You value balance and equality in relationships. You want effort from both sides, not just one, and you never want to feel like a burden on anyone. That’s why you’d rather do things on your own than depend too much on someone else.

I also see that many men come forward with the idea of “providing” for you, but the moment they see you already have everything you need they freeze. They get uncomfortable because suddenly, they have nothing left to offer. And this shakes their identity, because so many men build their sense of self-worth on how much they can provide for a woman or a family. With you, that old pattern doesn’t work anymore, and that’s exactly what makes you powerful. Another message I see is that you might have a small face or puffy cheeks that makes you look really cute. Some of you might have a mole near your eyes.

Thank you so much for reading this pick-a-card! 💗 If this resonated with you, don’t forget to show some love by liking reblogging or commenting ✨

TIP JAR

┅┅┅┅┅┅┅༻❁༺┅┅┅┅┅┅┅

This is a general reading, so it may or may not resonate with you. Take what feels right and leave behind what doesn’t, trust your own intuition first. 💗

Do not copy, rephrase, or repost my content on any other social media without my consent.

[superstarhodaya]

Pile 1 is so accurate!

[stay-close]

“If you hear a voice within you say “you cannot paint”, then by all means paint, and that voice will be silenced.”

— Vincent van Gogh

[galaxygirl-8-deactivated2026012]

hi there, i stumbled upon your blog recently and i really like the advice you give so i was hoping to get some advice of my own.

i’ve been familiar with the loa for about 7 years now through subliminals, so i do believe that manifesting works — but for me, i’ve never gotten any kind of big results. i used to get tiny results here and there but for a long, long while now i have been unable to see any kind of visible changes whenever i manifest. it’s conflicting because while i know that it’s very possible for me to have what i want, sometimes it’s just hard to not feel the doubts creep in when you see everyone else get instant results but you. i know that there’s no wrong way to manifest but i can’t help but feel like i am somehow doing something wrong.

i’m in a situation right now where my life is pretty much at an all time low, and i’m trying to manifest myself out of these circumstances. despite the lack of results, i am still a firm believer in loa and i still do hope that i’ll be able to get everything i want, i’m just unsure how to go about it now.

i think i covered everything about my situation, so i was hoping if you had any advice for how to deal with it. thank you so much for your time 🤍

Hello!

If you truly knew the Law, you wouldn't say you're trying to "get out" of a situation. Because you don't need to get out of anything. YOU DON'T NEED TO DO ANYTHING IN 3D.

3D IS DEAD, DO YOU KNOW WHAT DEAD MEANS? It's just a reflection. IT CAN'T GIVE YOU ANYTHING NEW. You don't change the mirror to see a different outfit — you change the outfit, and the mirror follows. Or do you want to tell me it's not like that?

You've said you still believe. Perfect. Now stop looking for proof outside. Stop chasing. Manifestation isn't about making something happen; it's about accepting it's already so inside.

"Forsake the world and change your conception of self." — Neville

You need to assume. Feel. Live as who already has.

[sourappl3s-deactivated20250803]

literally on point.

[perfeqt]

“Your vision will become clear only when you can look into your own heart. Who looks outside, dreams; who looks inside, awakes.”

— Carl Jung

[anxeious]

[spicychickenfingerings-deactiva]

[quotefeeling]

“Change your conception of yourself and you will automatically change the world in which you live. Do not try to change people; they are only messengers telling you who you are. Revalue yourself and they will confirm the change.”

— Neville Goddard

[authenticbunni]

You don’t have to act like the 3D has changed

Yes, read that again and again and again. It is 100% true.

You’re not meant to gaslight yourself and deny the 3D. You must accept that’s how THAT reality will go and that’s also NOT YOUR reality. Having a knowing of that creates disconnection between the old story and who you truly are. Not having a knowing of that and constantly worrying about it and fearing it makes you connected to your old story. Stop worrying about stuff (3D) that has nothing to do with you.

You have nothing to change but self. What I mean by that is change where your mind is at, not your thoughts. Your thoughts and mind are two different things/parts. As long as you change self it must externalize. There is nothing to change or create but your mind, you’re not creating nothing in the 3D because it is already done in your mind, only your mind matters nothing else.

[capellla-deactivated20250914]

"ᵀʰⁱˢ ᵗʰᵃᵗ ᵖʳᵉᵗᵗʸ⁻ᵍⁱʳˡ ᵐᵃⁿᵗʳᵃ, ˢʰᵉ'ˢ ᵗʰᵃᵗ ˢᵗᵘⁿⁿᵃ, ᵐᵃᵏᵉ ʸᵒᵘ ʷᵃⁿⁿᵃ ˢʷⁱⁿᵍ ᵇᵒᵗʰ ʷᵃʸˢ"

Why Are You So Pretty? | PAC

I know it's hard to feel beautiful or confident sometimes and especially in these times many of us are struggling with this. But I believe that we all have a unique beauty. Do you want to know why you are so pretty? Choose the image or images you are most drawn to and see.

Pick an Image

Paid Readings Masterlist Dividers -> @dollywons

1-

Oh first of all, you have so many parts that will make you look pretty. When the wind blows and covers all your feelings and you are one step closer to feeling free, you will realize how beautiful you are. Because there are so many things that really make you beautiful. And let's take a deep look at them.

Your dark side makes you beautiful. Yes, you heard right. When the whole world is dark and everything has lost its color and you have perhaps lost all your light.. you look beautiful. The reason you look beautiful lies deeper. Think of a story in a book where a character living in darkness actually gains and discovers his true power. There is so much to discover in you and your angels and tarot cards whisper that you look like a lotus flower in contrast to all this darkness. Unique and difficult conditions and surrounded by ugliness, but you are truly beautiful in the midst of it all. Purely, even if there are flaws that try to pull you down, maybe a scar or more, but what makes you beautiful is everything that makes you who you are. And that whole that they all form together.

 If nature spoke more it would surround you like a princess or prince and offer you its fruits. There is something natural about you, a natural and commanding beauty. Quiet and only your eyes speak and it is felt in your aura. There are dark parts but it is attractive. I see the leaves falling in the blowing wind, none of these leaves are rotten, they just cannot resist the wind. The words and actions that come from you are exactly like that. There is something irresistible about you. A stunning power. And you truly command silently, and the beholder cannot resist you. There is something deep and peaceful about you in this depth, perhaps you have balanced and calmer facial features. The shape of your body does not matter, every body shape is beautiful and we do not question that in this reading. I am talking about the things that make you unique and beautiful and that are special only to you, and the deeper I look into you, the more I discover in you. A predator tearing apart its prey, a mother adoring her newborn baby... and a calm sky in the middle of all of this, that sky is you. Do you get the vibe I am trying to give? In all that chaos, everything finds you again, everything becomes complicated, maybe it becomes wild, maybe it becomes compassionate, but it comes back to you. You have this aura too, calm but more.

When we look at the moon and all the other celestial bodies, we see that they all move in a beautiful order. Sometimes some stars explode and go out, sometimes a meteorite hits the earth and brings an end to it. In all the order, you see both the scary and the beautiful at the same time. And time has no meaning. I am telling you these because your appearance seems to reflect this. Take a look at everything you see as ugly and dark in yourself, you will realize that you actually have a perfect order and its real effect. No matter how you see yourself, everything you find dark and unattractive, that is where your power lies. You may have a balanced facial feature and a plus feature that you think completely spoils your appearance, but this is far from making you ugly, it gives you a strong aura. He who is calm and lost in silence is not weak or ineffective, you should know this.

2-

Wow, I can tell just by looking at the cards how pretty you look. No matter what you do, there is something that shines in you; like love, passion, strength. No matter what situation you are in, you hold your head high and don't let anyone talk bad to you. Because you know that you only have yourself, that you can take refuge in yourself. Others may call it selfishness, arrogance, hypocrisy, but you know very well what the truth is. There are many things that make you beautiful. And knowing your own worth is one of them.

You have a mature energy and you could have more defined features. Maybe more curves or maybe more defined facial features. Your hair suits your face very well, especially when you leave it natural. It suits you very well with its natural color and shape. You look beautiful when you cry. When you show your true strength and are not afraid of reactions, when you carry the difficulties proudly like a victory on your back, and when you work with the calloused curves of your hands, you are truly beautiful.

You make people fall in love with you. And you become the love of their lives. God is looking down and smiling. The sun is showing itself again. Your beauty is a blessing.

Have you ever wondered why other people run away from you or distance themselves? It is because of your power. People are aware of this and are afraid because they are used to superficiality, they are used to fakeness, they are not ready to hear the truth, not at all.

You live like love, the bowl of food you make is full of love, your hands are full of love when you water your flowers, your smile is full of love when you smile at someone. Seeing and loving you is like a long journey, there is so much to discover, so many landscapes to see, deep blue seas, birds flying in the sky. It is very difficult not to get lost in you. If you can find someone who can truly understand you and is not afraid to look at a map, then you will understand. And when the words that come out of this person's lips tell you how beautiful you are, then you will understand. Because while you are moving forward freely and carrying those difficulties on your back, you are missing out on so much about yourself.

Loving you and seeing you is like everything coming together one after another. Your beauty creates a sense of harmony in people, when they look at you, they remember how beautiful life really is. And they want to get lost and discover you.

You have a beauty that stands the test of time, whether it is primitive times, renaissance or modern times, wherever and whenever you are, you have a face and beauty that can be called beautiful.

You have a life-giving and magnificent aura like a willow tree, maybe simple, maybe strong, maybe powerful, maybe flowing like water. And everyone who sees you pauses for a while to digest what they see, because they know, They know how pretty you are.

3-

When people first look at you, they may see arrogance or a power looking down on others. But I know there is more to you than that. They don't see it because they don't actually look, because the truth isn't really hidden deep down.

The sun shines behind you and makes your hair shine, could you have been a king or a queen in a previous life? Maybe a goddess? Even flowers feel ashamed in the face of your beauty. I could call you arrogant, overconfident and spoiling the fun, but these are the words of someone who is superficial and doesn't know how to see beauty.

You walk down the street as if you were on a stage and God is my witness, it is impossible not to look at you. Your beauty lies in the passion within you, your beauty lies in the flame within you. You are beauty itself. There is not a single part of you that doesn't reflect the light of your beauty. That chic necklace you wear as an accessory, your ID that says your name, the touch of your skin and the spark it gives off, you scream I am beautiful.

Keep showing yourself and being free or crazy, because people need to see this beauty. And don't be afraid to go against others or be too much for them, everything that makes you unique was created for this. Show them off and show what beauty is. Because this ugly world needs it.

And what is called "real" to others, ordinary beauty rules don't matter because you are more than them. You are more than superficial beauty rules and you transcend them. I can't lie, you have an energy and aura that not everyone is familiar with or can handle. You can't look at a sun for a long time, it damages your eyes. So you should accept some people's reactions naturally.

There is also something complicated about you. Maybe your hair gets tangled, then you go in front of the mirror with your newly woken up and swollen eyes, looking messy but very sexy. How is this possible? Can we call it a blessing or is it just because of the natural aura you emit that is special to you? I won't give the answer.

You don't think twice, you make a decision with your whole being and get down to business. Courage finds its name and existence in you. Life shows itself in you. It's like a magic spell, but it's nature. Someone who doesn't know may blame you, may say that "this person was born with luck", that everything he has is due to luck. But they will probably never know. They will never know what it means to be you. There is nothing exaggerated about you. It's like blaming the sun for shining too brightly. But there is also the fact that you can't block the sun's light, you can hide behind curtains, but that doesn't mean that the sun isn't still shining. That sun will always continue to show itself and shine. That's the truth.

4-

There is a rich energy in this pile. Clothes or money make everyone look beautiful so I won’t talk about that. I will only talk about the richness that is unique to you. You may have a different and rich cultural origin. And I see that you still somehow preserve these traditions. Whether it is with your style or your facial features. And that makes you look very pretty.

As I write these exact words, a song with the lyrics; “so pretty it hurts” is playing in the background. I know this is not a coincidence. There is something about you that makes you feel distant and at the same time very close. I want to touch you, I want to be closer to you because you are so beautiful but every time I try to touch you, you seem to move away. You make me feel very beautiful. I close my eyes and pray. You have a beauty that prays. In a pure and rich way.

I see you with your compassionate eyes telling someone something and petting a puppy. There is a spiritual air about you, a nostalgic air. Your aura makes me sigh. I feel all the sincere beauty in the world in my heart. The fact that it will all end one day makes everything more beautiful. If you are afraid of losing all the beauties you have, you should not be afraid of this. As long as your beauty exists, it is an inspiration at every age and moment.

Because you are unique and original. You are unique and you should know that one day for someone, today for someone else, you are very special and precious.

Sometimes you have to lose something you have to understand its value, I will not look at what you have lost in your life or go into this painful subject. But every wound and every scratch made you more beautiful. You had to go through these roads to have the richness you have today. Because all these memories and the marks left on your soul are what make you unique. All these marks change themselves and those wounds are filled with colorful healing energy and leave unique marks on your soul.

You are destroyed and reborn, and among all that pain, chaos and ruins, a flag is seen touching the sky. You have this wealth, this aura.

All the cosmic components come together and witness you. They enable your richness. Your beauty has more than what ordinary eyes can see. When I look at you, I see true power and nobility. I witness the true moment. The birth of a world, the birth of a child and its continuation... your eyes that make the world rich come before my eyes. They are full of light and something I cannot name. And all of this inspires me. Your beauty transcends the ordinary of the physical world.

5-

You are very beautiful and pretty. I thought for a long time how to explain it better and put it into words, but I guess there is no need for that. You have a beauty that can be accepted by everyone. You are conventionally attractive. The kind of beauty that people want to serve, want to approach you, want to be near.

There are many different colors in you, but the color I see the most clearly is black. You are like black, noble, darkly rich. But don't take my words in a negative sense because it has nothing to do with it. Black only suits you and shows your own power. Like a black hole, you attract people to you and nothing else shines where you are.

But I see that you are quiet and do not boast about all these beauties. You should not hesitate to appreciate and show them because it is the most natural thing you have and it is your right.

I will say this for those of you who are not aware, from your body shape to your facial features, you are considered beautiful by the vast majority. But is that important? No! Other people's opinions are completely unnecessary. In this reading, I will only focus on why you are truly beautiful, not on other people's selfish opinions.

I am taking the Jupiter and financial gain cards. I don't even need to tell you that you are beautiful. Because you being beautiful is a fact. It's not relative. But if I were to describe you through the eyes of people who truly love you and know you well, that's a completely different topic. You have so much more, there really is so much more.

You are noble, proud, your heart is rich but you don't give more than much to those who don't deserve it. You are aware of your power and value. Even animals and nature are drawn to you. Because you carry the most beautiful aspect of nature on your face and soul. The idea that beautiful people have ugly hearts or arrogant hearts is wrong and you are proof of that.

You are also talented, and no matter how big your dream is, this adds beauty to your beauty. People discover that there is more to you and it definitely surprises them. You have the beauty and talent that can be presented to a movie or a magazine. And you shouldn't ignore all of these, you should let them shine. You are like a reality living in a region where all the swords and lies are. That's how your aura feels. It's sharp and striking, it's noticeable and it makes it hard to even breathe. But then I calm down and the more I feel you, the more I find peace and acceptance. I accept that you are beautiful.

6-

Your beauty is like the moon, like breath, like a newly opened flower. It may seem weak and fragile, but that is far from the truth.

You break people, you break them, you make them dizzy, you make them weak. Because your delicate beauty tells them that you are the one who is fragile, but they cannot see the truth. I see that you have a truly pure beauty and appearance. Very romantic and like a poem. You have the beauty that could inspire a painter, a poet, a writer.

Contemplative and nostalgic, and your eyes shine in the darkness. And suddenly all those songs, poems, paintings come to life. Your style makes you completely special. You are completely yourself and you show and spread something of yourself to those around you. Some people judge this as being too different, while others admire it and want to be like you. But I have to say this. You do not yet know the truth very well in yourself. You do not yet know how much there is to discover in you and how much beauty you have.

The light in a weak lamp, a noble flower squeezed behind a glass, you radiate a beauty that you cannot bear to touch. It embraces you like a dream and makes you forget who you really are. Your beauty is intoxicating, and makes people want to get lost.

I want to hold your hand and show you all the beauties of the world. I want to make you taste new tastes and give you new pleasures. I want to trust you. You awaken these feelings in people. No matter how old you are, you look and will look younger than you are. I must say this. And this is one of the qualities that make you pretty.

This is very interesting because I get the moon and sun cards at the same time. Again. You surprise people.

You have the fragility of a moon but the power of a sun. Some think of you as a powerful source of light and joy, while others see you as the cause of their suffering. You make people experience different feelings at the same time. You make their heads spin and make them question the world. You are far from ordinary.

People claim your fragile beauty but avoid talking about the powerful effect you have on them. This is pure cowardice on their part and a pointless subject that I will not even mention. You are setting people free. You are breaking all those expected and believed standards of beauty and bringing innovation.

[superstarhodaya]

5✨🫶

[mxrcurysb1tch]

˚₊‧꒰ა ☆‧₊˚ Astrology observations pt. VI˚₊☆ ໒꒱ ‧₊

✮ As always, take what resonates and leave the rest. xo

✮ Women with Venus in Leo want the red carpet rolled out for them in love. Give me the princess treatment, fly me to Paris, check us in at the Ritz, buy me designer, show me off. Men with Venus in Leo are pulling all the stops in love. They’re the ones splashing out, being extremely chivalrous. I know a guy with this placement and he’s usually super stingy but when his girlfriend is involved he makes sure she is treaaaateedd.

✮ I once read somewhere that mercury retrograde natives get really annoyed and frustrated when technological errors happen, when the WiFi is loading slow, when they don’t understand how something works on a computer etc. And idk about you guys but as a native myself, I can definitely relate lol!

✮ Speaking of mercury retrograde, I often find that when two natives meet each other, they either understand each other on a whole different level or they c o m p l e t e l y misunderstand each other and butt heads constantly and just generally get on each other’s nerves.

✮ 10h moons and being great musicians. I’ve noticed that a lot of musicians, especially ones that write their own songs have this placement and I think it’s because they’re so good at laying out the details of their lives in their songs and their emotions are a key component in the success of their career.

✮ *sigh* this is one I’m so tired of hearing. Capricorn isn’t just about being obsessed with money, materialism and capitalism. It’s about success, improvement, and mastery. Now I can see the overlap between the two ideas and the significations are definitely there for a reason. In our culture, the sign of success is having the money and the career, the house, so yes those things are likely to be attractive to a Capricorn. However it could just be about being successful and improving in any area of your life not just money and career.

✮ 6h stellium and/or moon might suffer from major health anxiety or intrusive thoughts, even OCD in extreme cases.

✮ Chiron 9h/sagittarius You might feel completely lost in life and like nothing has any meaning. You might have a confusing relationship with religion or be into nihilistic philosophies. Travelling and exploring the world can offer you a sense of purpose and meaning.

✮ Neptune aspects to personal planets can make a person feel very in tune with the psychic world and the energy of the collective unconscious. They might easily pick up on energetic shifts on a societal scale. The type of aspect will show how the native feels about this, what they choose to do with this ability and if it is a hindrance or help to them.

✮ Uranus aspects to personal planets can make the native very susceptible to understanding trends and behaviours in society. They may have a sixth sense predicting trends and people’s behaviours before they happen. I think this is especially prominent for those gen z that have Uranus in Pisces. Uranus aspects to personal planets can also make the native very ahead of their time, and they may propose extremely controversial or shocking ideas and observations that later turn out to be astute and extremely popular. With hard aspects, the native can struggle to harness this power for good and may rub people up the wrong way or even disgust them with their outlandish ideas. With more benefic aspects, the native can be seen as a visionary, someone to be revered and followed.

[astrologydray]

😩😩Rising Signs as Style Personas: Men/masculine edition😩😩

Aries Rising – The Alpha Statement-Maker

• Athletic streetwear, combat boots, muscle-fit tees, bomber jackets, and jeans. elements like leather, denim, and statement pieces. tailored pieces like blazers, jackets with sharp lines, and well-fitting pants

• Red, black, and bold colors; Don't shy away from other bold hues like orange, yellow, and hot pink. strong silhouettes. experiment with unique looks. faux fur, animal prints, or distressed fabrics

• Sporty meets rebel energy (think: leather jackets, fitted joggers) Edgy & Trendsetting. Bold & Eye-catching

• Vibe: Confident, daring, always ahead of the trend

What to Avoid Wearing:

• Anything too soft, pastel-heavy, or romantic. Oversized fits that hide your assertive build

• Overly neutral or “quiet luxury” that feels passive

Taurus Rising – The Luxe Earth-Toned Classic

• Cozy, high-end fabrics (cashmere, suede, organic cotton). Well-made, durable pieces. such as well-tailored suits, quality leather shoes, and classic accessories

• Earth tones (greens, and deep blues) neutrals, olive, cream, chocolate brown

• a refined, understated style rather than overly trendy or flashy looks. a classic watch, a simple bracelet, or a quality leather belt as key accessories. Quality over Quantity

• Vibe: Rich, warm, slow fashion king

What to avoid Wearing:

• Loud logos, synthetic materials, or cheap fabrics. Anything too uncomfortable or overly trendy

• Harsh color blocking—stick to soft blends and textures

Gemini Rising – The Whimsical Chameleon

• Layered streetwear, bucket hats, mixed patterns

• Pops of color (especially yellow, mint, light blue). Their fashion choices may reflect their intellectual curiosity and love for communication

• Y2K, vintage, or experimental fashion hybrids giving Versatility and Adaptability.

• Vibe: Playful, unpredictable, and always current

What to Avoid Wearing:

• Super serious or corporate looks that mute your playful energy. All-black or monochrome outfits too often

• Stiff fabrics—flexibility is key

Cancer Rising – The Soft-Edged Romantic

• Vintage sweaters, cozy textures, warm layers. incorporating elements from the past into their fashion vintage or retro

• Soft neutrals, seafoam green, rose tones. pastels, moonlit shades, and blues, including cerulean, sky, lapis, teal, or even arctic.

• Casual elegance—button-ups over tees, wool coats, Cozy Knits and Oversized Sweaters. Heirloom Jewelry: Add a touch of personal history and significance

• Vibe: Emotionally stylish, intimate, nostalgic

What to Avoid Wearing:

• Harsh lines or icy fashion aesthetics. Clothes that feel too “masculine-coded” or rigid

• Cold, metallic color palettes

Leo Rising – The Regal Showman

• Statement pieces, bold patterns, gold jewelry, bold watches, stylish sunglasses, Gold necklaces, eye-catching rings

• Designer streetwear, custom tailoring, dramatic coats. A sharp, well-fitting suit in a rich color. Luxurious fabrics like velvet or silk, satin

• Jewel tones like gold, crimson, and royal blue or yellow, orange, red, and magenta

• Vibe: Spotlight-ready, never underdressed

What to Avoid Wearing:

• Super plain fits, especially if they mute your presence. Cheap or flimsy materials—your aura deserves more

• Neutral palettes that erase your shine

Virgo Rising – The Clean Precisionist

• Sharp tailoring, neat fits, elevated casual wear, polished and put-together look

• Crisp whites, navy, beige, olive, brown, green, blue, and tan

• Structured pieces: polos, chinos, trench coats

• Vibe: Minimalist, intentional, impossibly clean

What to Avoid Wearing:

• Cluttered or chaotic patterns. Oversized, sloppy streetwear (unless it’s tailored)

• Trendy, throwaway fashion without purpose

Libra Rising – The Harmonized Prettyboy

• Matching sets, silk shirts, perfect layering. Quality chinos, button-down shirts, and cashmere sweaters

• Soft pastels, balanced color blocking, clean sneakers, Dusty rose, deep coral, and midnight blue.

• Stylish with romantic undertones (scents, grooming, accessories) shades like watermelon, coral, punch, fuschia, and strawberry pink. Denim, berry, indigo, spruce, peacock, and navy blue are also good options.

• Vibe: Effortless charm, aesthetically gifted

What to Avoid Wearing:

• Mismatched patterns, clunky shoes, or dirty details. Harsh “alpha” fits that throw off your balanced energy

• Outfits that look too rushed or undone

Scorpio Rising – The Intense Icon

• All-black everything, dark denim, leather boots. Deep reds, black, purples, maroons, and burgundies. Denim, berry, indigo, spruce, peacock, and navy

• Fitted pieces, trench coats, silver jewelry. leather, velvet, and satin

• Sexy without trying: mesh, open collars, deep V’s

• Vibe: Mysterious, powerful, hard to read

What to Avoid Wearing:

• Bright neons or loud graphic tees.. Overly “friendly” or bubbly fashion

• Excessively baggy clothing that hides your allure

Sagittarius Rising – The Explorer Adventurer

• Layered flannels, denim jackets, printed shirts, hats, scarves, statement jewelry, or unique belts to complete their looks

• Rustic color palettes: burgundy, navy, forest green

• Hiking boots, lived-in leather, festival fits. Bohemian/Eclectic touches: elements like flowy silhouettes, ethnic prints, or vintage-inspired pieces.

• Vibe: World-traveled, spontaneous, cultural

What to Avoid Wearing:

• Overly structured or restrictive fashion. Repetitive looks—your style thrives on movement

• Anything you can’t breathe or run in

Capricorn Rising – The Power Dresser

• Executive neutrals, high-end tailoring, quiet luxury

• Fitted turtlenecks, crisp blazers, designer watches, Dark wash jeans, White button-downs and polo shirts . Classic coats and jackets in neutral colors

• Black, charcoal, taupe, forest green, navy, gray, and white, browns, ochres, and dark greens

• Vibe: CEO energy, rich and respected

What to Avoid Wearing:

• Over-the-top streetwear or cartoonish prints. Messy or rebellious fashion

• Inexpensive-looking fabrics that clash with your prestige

Aquarius Rising – The Style Alien

• Futuristic fashion, unique color pairings, gender-fluid silhouettes. embracing trends early and can even be trendsetters

• Metallics, layered chains, cyberpunk or thrifted one-of-ones

• Iridescent, bold accessories, and asymmetry

• Vibe: Unpredictable, iconic, walking Pinterest board

What to Avoid Wearing:

• Basic “mall fashion” or generic trends. Super traditional or stiff, conservative clothes

• Anything too normal—you’re built to defy boxes

Pisces Rising – The Ethereal Artist

• Linen, cotton, and silk. soft textures, layered neutrals, artistic accessories, relaxed fits, and unique accessories like beaded necklaces or woven belts; Bohemian & Eclectic Touches

• Colors like seafoam, lavender, ivory, ocean blue, blues, in general, greens, purples and softer pastels.

• Dreamy fits: oversized sweaters, scarves, painter pants, linen shirts,

• Vibe: Poetic, imaginative, unbothered by the real world

What to Avoid Wearing:

• Harsh lines or stiff, military-inspired fits. Strong neon or heavy black on black—too harsh

• Super minimalist looks that erase your softness