Mellow Yellow studyblr

she/her, aesthetic, art, gaming, and shitpost blog

[mollybeenoel]

[fortunatelychaoticphantom]

I swear to fucking god. I would claw out OneDrive from my computer if I could. I would burn down their servers if I could. I would run down their stocks to the ground if I could. I hope every single one of their workers gets a better offer from a competitor in the next 24 hours. I hope every single one of their light bulbs explodes at the same time. I hope every single carton of milk in their fridge will always be expired.

Stop backing up my fucking files.

Stop asking me to back up my fucking files.

Stop taking my fucking files off my fucking computer.

I don't want a fucking reminder in three fucking days. Let me fucking say no.

Fuckers.

[prismatic-bell]

Friend, I have news you're gonna love. Here's a text tutorial to get rid of that shit on Windows 10.

Here's a text tutorial to get rid of that shit on Windows 11.

Here's a video tutorial to get rid of that shit on Windows 10.

Here's a video tutorial to get rid of that shit on Windows 11.

Go forth. Be free.

[blueskittlesart]

traditional happy pride month from everyone's favorite transgender video game characters

[cloverscry]

reposting these, i touched up some ink and colors and took better photos 💛

[helianthus-annuus777]

[soulfulconnection]

Akiya kageichi 

[modern-austen]

subtitles from Science Gossip, 1900

[maezanilla]

Harrow doodling

[middenprincess]

i can’t stop laughing at this

[chrysochromulina]

Who was the most attractive?

Crosby

Stills

Nash

&

Young

Voting ended onOct 30, 2024

[rev0lverluvr]

[teaboot]

[ringside]

average day on the mithraeum

ianthe: haha harrow wants me so bad it makes her look stupid 😈

mercy: why didn’t i kill myself ten thousand years ago

john gaius: [playing 2048 on his ipad] my life is completely normal and great and my friends all love each other :)

gideon the first: i think i have encephalitis

augustine: when i’m in the club yeah im bumpin that 365 party girl bumpin that should we do a lil key should we have a lil line wanna go real wild when im bumpin that meet me in the bathroom if you’re bumpin that 365 party girl bumpin that french manicure wipe away the residue

pyrrha: i’m pretty sure gideon has encephalitis

harrow:

[themagicforest]

Little things that feel like spells:

the sound of wind in trees like they're whispering secrets

old keys with no doors to open

puddles that look like portals if you stare long enough

half-finished poems tucked into coat pockets

dusty attics where forgotten memories nap

candlelight flickering like it’s trying to talk

tea leaves swirling like they’re casting fortunes

cloudy days that turn the world into a watercolor

finding feathers in strange places like a bird witch left them behind

[charl0ttan]

i swear to god that social cue wasnt there before

[museify]

[asoftspotforangels]

some of my favorite woven tapestries, by Cecilia Blomberg:

Point Defiance Steps

Mates

Rising Tides

Vashon Steps

[biggest-gaudiest-poltergeist]

i didn't say it was good, i said it has bewitched me body and soul

[ka-di-gan]

[spicychickenfingerings-deactiva]