Well//Umm//Err

The gods are asleep, commit acts of light hubris °˖✧◝(⁰▿⁰)◜✧˖°NSFW.

[wellummerr]

My new hoodie has thumb holes!!!!

[normal-horoscopes]

[theconcealedweapon]

[mhouseofm2]

[spicychickenfingerings-deactiva]

when I find out he likes Pokémon too

[sandersstudies]

Sick list of symptoms bro. Now try humanizing your behavior instead of pathologizing it.

[sandersstudies]

Pathologizing: Hey sorry I yelled at you. I have this ADHD symptom called RSD that makes me really sensitive.

Humanizing: Hey, I’m sorry that I blew up like that earlier. In the moment I felt really attacked and overwhelmed and I reacted badly, but I know you didn’t mean to offend me with what you said, so that behavior is on me.

[queer-asinfuckyou]

Because I just saw a post bitching about this one, I want to add: this post is saying that you need to take accountability for the way you hurt other people, even if it happens because of a symptom of your disability/illness. It's also saying that using terms (especially acronyms) that aren't common knowledge isn't a helpful way to explain yourself. It is NOT saying that you need to let people walk all over you because "your disability isn't an excuse."

If you're diabetic, you don't have to eat the honey glazed ham that will send you into a coma (their example). But you also can't yell at the person offering it and accuse them of trying to kill you. You can just say "thanks, but my body can't handle that kind of sugar intake, so I'll pass"

[ayin-me-yesh]

If you run over someone's foot with your wheelchair you still apologise

[c3rvida3]

When I was in the hospital, they gave me a big bracelet that said ALLERGY, but like. I'm allergic to bees. Were they going to prescribe me bees in there.

[mothocean]

[asphodelimago]

So there's a medication called hyaluronidase. It's used to make other medications absorb better, because it makes the cell wall more permeable.

One common usage is to make local anesthetic more effective during surgery, for instance. It's used in a number of injected medications.

Bee stings contain an enzyme very similar to this medication, so sometimes, people with bee allergies have an allergic reaction to hyaluronidase.

This is called cross-reactivity, where your body mistakes something for the thing it's actually allergic to, and has an allergic reaction anyway. For instance, sometimes people with latex allergies also are allergic to bananas and other fruits. They don't actually contain latex, but there are some similar proteins.

Apparently, hyraluronidase used in humans is derived from one of four sources: sheep testicles, cow testicles, cow testicles again, and GMO hamster ovaries.

tl;dr: They won't inject you with bees, but they might inject you with purified cow testicle juice, and your body might say 'eh, cow balls are BASICALLY bees' and try to kill you anyway.

[bearbellyblog]

The world is full of such beauty and wonder. Thank you for that sentence.

[hotvampireadjacent]

Sweden ????

[ashketchupandfries]

So Sweden used to give random citizens control over the official @Sweden Twitter account for like a day/week/month or whatever. As you can see why, it didn’t last long

[leninthesixth]

what do you mean it didn't last long they did this for like seven years between 2011 and 2018 they didn't stop doing it because someone tweeted about cock sdfgsdfgsdfgsdf they kept doing it for four more years after this

[plaguedocboi]

Are you guys aware of chimney swifts??

They’re in the same order as hummingbirds and, in some positions, you can see the resemblance

But like… a hummingbird that’s cosplaying as a falcon.

Sleek. Efficient. Aerodynamic. Perfectly optimized.

Also they like to sleep in chimneys, hence the name, and when they perch they become very very flat

They also like to sleep in groups

Anyway 10/10 weird little beast. Love these little flat fuck hummingbird falcons

[depsidase]

[gutsandeverythingg]

Who are you and why do i follow you

do i really have to do this every time. you are a mindless ghoul. i own you. you dig my endless pit. BACK TO WORK

[spatscolombo-deactivated2022030]

How DARE Tolkien omit in the final draft the information that the traditional hobbit marriage custom is to have unspoken vibes for years and then disappear without explanation for an indeterminate length of time!?

[tehri]

#where's the fic where bilbo returns with thorin in tow and no one bats an eye#like#'he married a dwarf did he? well he always was an odd fellow'#'good day to you master dwarf how's your husband?'#and thorin is just ?????#'how do they know i'm courting him? did he show them the mithril shirt?'#just give me all the hilarious culture clashes ok

@finegoddamnit​ how dare you hide this in the tags

[nevertheless-moving]

so that whole time merry, pippin, sam, and frodo are gone the whole shire is losing their minds arguing over who married who.

[the-toy-boy]

[ghostshark]

Malcolm in the Middle if it were a 90s indie art film

[harsh-noise]

[evy-shmurda]

[kestarren]

Fallstreak hole in south eastern Ontario (over Ottawa), Canada. Photo by oneflightlessbird in r/CLOUDS, on Reddit, 8 May '26. "The holes are caused by supercooled water in the clouds suddenly evaporating or freezing..." - Wikipedia The photo went into Wikipedia on the same day, under Examples.

Fallstreak hole - Wikipedia